Recombinant Human Renin receptor(ATP6AP2)

Code CSB-YP002384HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. O75787
Relevance Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias ATPase H(+)-transporting lysosomal accessory protein 2ATPase H(+)-transporting lysosomal-interacting protein 2ER-localized type I transmembrane adaptorEmbryonic liver differentiation factor 10N14FRenin/prorenin receptorVacuolar ATP synthase membrane sector-associated protein M8-9
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Research Area Signal Transduction
Source Yeast
Gene Names ATP6AP2
Protein Names Recommended name: Renin receptorAlternative name(s): ATPase H(+)-transporting lysosomal accessory protein 2 ATPase H(+)-transporting lysosomal-interacting protein 2 ER-localized type I transmembrane adaptor Embryonic liver differentiation f
Expression Region 17-350
Tag Info N-terminal 10xHis-tagged
Mol. Weight 40.0kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
Involvement in disease Mental retardation, X-linked, with epilepsy (MRXE); Parkinsonism with spasticity, X-linked (XPDS)
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium,
Database Links

HGNC: 18305

OMIM: 300423

KEGG: hsa:10159

STRING: 9606.ENSP00000367697

UniGene: Hs.495960

Pathway Renin-angiotensin system

Related Products

ATP6AP2 Antibodies

ATP6AP2 Antibodies for Homo sapiens (Human)

ATP6AP2 Antibodies for Human

ATP6AP2 Proteins

ATP6AP2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.