Recombinant Human Renin receptor(ATP6AP2)

Code CSB-YP002384HU
Size US$1298
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names ATP6AP2
Uniprot No. O75787
Research Area Signal Transduction
Alternative Names APT6M8 9; APT6M8-9; ATP6AP2; ATP6IP2; ATP6M8-9; ATPase H(+)-transporting lysosomal accessory protein 2; ATPase H(+)-transporting lysosomal-interacting protein 2; ATPase H+ transporting lysosomal accessory protein 2; ATPase H+ transporting lysosomal interacting protein 2; ATPase H+ transporting lysosomal vacuolar proton pump membrane sector associated protein M8 9; ATPase membrane sector associated protein M8 9; ATPase; H+ transporting; lysosomal (vacuolar proton pump) membrane sector associated protein M8 9; CAPER; ELDF10; Embryonic liver differentiation factor 10; ER localized type I transmembrane adaptor; ER-localized type I transmembrane adaptor; HT028; M8 9; M8-9; MGC99577; MRXE; MSTP009; N14F; Renin receptor; Renin/prorenin receptor; RENR_HUMAN; V ATPase M8 9 subunit; V ATPase M8.9 subunit; V-ATPase M8.9 subunit; Vacuolar ATP synthase membrane sector associated protein M8 9; Vacuolar ATP synthase membrane sector-associated protein M8-9; vacuolar proton ATP synthase membrane sector associated protein M8 9; XMRE
Species Homo sapiens (Human)
Source Yeast
Expression Region 17-350
Target Protein Sequence NEFSILKSPGSVVFRNGNWPIPGERIPDVAALSMGFSVKEDLSWPGLAVGNLFHRPRATVMVMVKGVNKLALPPGSVISYPLENAVPFSLDSVANSIHSLFSEETPVVLQLAPSEERVYMVGKANSVFEDLSVTLRQLRNRLFQENSVLSSLPLNSLSRNNEVDLLFLSELQVLHDISSLLSRHKHLAKDHSPDLYSLELAGLDEIGKRYGEDSEQFRDASKILVDALQKFADDMYSLYGGNAVVELVTVKSFDTSLIRKTRTILEAKQAKNPASPYNLAYKYNFEYSVVFNMVLWIMIALALAVIITSYNIWNMDPGYDSIIYRMTNQKIRMD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 40.0kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 10xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Functions as a renin and prorenin cellular receptor. May mediate renin-dependent cellular responses by activating ERK1 and ERK2. By increasing the catalytic efficiency of renin in AGT/angiotensinogen conversion to angiotensin I, it may also play a role in the renin-angiotensin system (RAS).
Gene References into Functions
  1. Increased level of s (pro) RR in first trimester may be a marker for predicting gestational diabetes mellitus PMID: 27654965
  2. Soluble (pro)renin receptor is dysregulated in pregnancies affected by diabetes mellitus, but not in preeclampsia. PMID: 29050747
  3. maternal serum concentrations may reflect acceleration of tissue renin-angiotensin system in the placenta and blood pressure severity PMID: 28864001
  4. The aim of this review, is to highlight new insights into the cellular and molecular mechanisms by which PRR may regulate UB branching, terminal differentiation and function of UB-derived collecting ducts, nephron progenitor maintenance, progression of nephrogenesis and normal structural kidney development and function--{REVIEW} PMID: 27160552
  5. Overexpression of PRR is associated with pancreatic ductal adenocarcinoma. PMID: 28874965
  6. the missense mutations in ATP6AP2 lead to impaired V-ATPase assembly and subsequent defects in glycosylation and autophagy. PMID: 29127204
  7. High ATP6AP2 expression is associated with Renal Damage. PMID: 27228084
  8. serum s(P)RR could be used as a marker for atherosclerotic conditions in hemodialysis patients PMID: 27367528
  9. (P)RR may contribute to the homeostatic control of erythropoiesis. PMID: 28090037
  10. Placental (P)RR can be involved in blood pressure regulation via the tissue RAS. On the other hand, plasma s(P)RR may be involved in the pathogenesis of decreased renal function in preeclampsia. PMID: 26684753
  11. the present results suggest that ATP6AP2 rs5918007T might be susceptible factors for Essential Hypertension in Chinese Han population. PMID: 26625836
  12. A mutation in the splice site following exon 2 may affect splicing due to its close proximity to the exon-intron boundary. It was associated with epilepsy, Parkinsonism and intellectual disability in 2 brothers. PMID: 26467484
  13. Study identifies a renin-angiotensin system-independent function for the (P)RR in the regulation of LDL metabolism by controlling the levels of SORT1 and LDL receptor. PMID: 26582775
  14. markedly expressed in adrenocortical zona glomerulosa and aldosterone-producing adenoma PMID: 25668351
  15. Prorenin receptor promotes atrial structural and electric remodeling and plays an important role in the pathological development of atrial fibrillation. PMID: 25697868
  16. Demonstrate that there are strong interactions between prorenin, ATP6AP2, and TGFB1 and that this system has a greater capacity in female amnion to stimulate profibrotic pathways, thus maintaining the integrity of the fetal membranes. PMID: 25491485
  17. a novel GLP1R Interacting Protein ATP6ap2 PMID: 26272612
  18. Crosstalk between (Pro)renin receptor and COX-2 in the renal medulla during angiotensin II-induced hypertension PMID: 25681793
  19. This is the first demonstration that (P)RR may be profoundly involved in ductal tumorigenesis in the pancreas. PMID: 25747895
  20. The binding of prorenin to PRR can promote proliferation and upregulate the anti-apoptotic protein Bcl-2 and downregulate the pro-apoptotic protein Bax independently PMID: 24591529
  21. MicroRNA-152 represses VEGF and TGFbeta1 expressions through post-transcriptional inhibition of prorenin receptor in human retinal endothelial cells. PMID: 25802486
  22. Data indicate that (pro)renin receptor ATP6PA2 interacts with the E1 beta subunit of pyruvate dehydrogenase and controlling its protein stability PMID: 25720494
  23. expressed by lymphocytes and macrophages PMID: 25503726
  24. activation of (P)RR and AT1R is associated with the pathogenesis of conjunctival EMZL by stimulating the production of FGF2 and MMPs. PMID: 25503453
  25. The aim of this study was to analyse the contribution of constitutive (P)RR activity to its cellular effects and the relevance of prorenin glycosylation on its ligand activity. PMID: 24424509
  26. The extracellular domain (ECD) and transmembrane domain (TM) of ATP6AP2 were indispensable for the biogenesis of active V-ATPase. PMID: 24223829
  27. The expression of (P)RR in erythroid cells, raising the possibility that (P)RR may have a role in erythropoiesis and the pathophysiology of certain types of anemia. PMID: 22884881
  28. Plasma levels of prorenin receptor are increased in heart failure patients with renal dysfunction. PMID: 23673200
  29. This study demonstrates that the the extracellular domain of ATP6AP2 participates in dimerization. PMID: 24472541
  30. Pro)renin receptor and insulin resistance: possible roles of angiotensin II-dependent and -independent pathways. [review] PMID: 22684035
  31. Plasma sPRR concentrations are dependent on ethnicity and independent of renin, prorenin, and aldosterone concentrations in healthy subjects and in patients with contrasted degrees of renin-angiotensin system activity. PMID: 24218434
  32. Studies indicated that various polymorphisms in the (P)RR/ATP6ap2 gene associated with increased cardiovascular risks. PMID: 24400720
  33. Results show that reduction of the full-size ATP6AP2 transcript in XPDS cells and decreased level of ATP6AP2 protein in XPDS brain may compromise V-ATPase function and may ultimately be responsible for the pathology. PMID: 23595882
  34. High s(P)RR concentration is associated with a lower SGA birth likelihood. PMID: 23555874
  35. Report the presence of prorenin receptor in human substantia nigra. PMID: 22407459
  36. The(pro)renin receptor mediates EGF receptor transactivation in both Ang II-dependent and -independent pathways. PMID: 23277024
  37. These in vitro data indicate that prorenin acidified in vivo possibly modulate renin angiotensin system in (pro)renin receptor-dependent and/or -independent manners which could ultimately lead to the pathogenesis of diseases. PMID: 23111329
  38. Our data using human samples provide the first evidence that prorenin receptor is associated with angiogenic activity in proliferative diabetic retinopathy. PMID: 22930161
  39. Data indicate that high circulating levels of s(P)RR at early pregnancy predicted a subsequent elevation in blood pressure, and high concentrations at delivery were significantly associated with preeclampsia. PMID: 23045457
  40. Prorenin is a chemotactic factor for human aortic smooth muscle cells expressing prorenin receptor. PMID: 22721990
  41. (P)RR gene activity may be controlled by intracellular AngII. PMID: 21997900
  42. Angiotensin generation depending on prorenin-(P)RR interaction may occur in transgenic rodents overexpressing prorenin several 100-fold. PMID: 22025376
  43. Decidual prorenin may be involved in the labour-associated increase in amnion PGHS-2 abundance via the (pro)renin receptor. PMID: 20702505
  44. that (P)RR influences blood pressure regulation in Caucasian men, potentially through altered aldosterone release PMID: 21346687
  45. Prorenin receptor is mainly localized in the subcellular organelles, such as the endoplasmic reticulum and Golgi apparatus, and the prorenin receptor is cleaved by ADAM19 in the Golgi, resulting in two fragments. PMID: 21270819
  46. The polymorphism of the (P)RR gene +1513A>G is associated with lacunar infarction and left ventricular hypertrophy in Japanese women. These results suggest that (P)RR has a role in organ damage in humans PMID: 21228785
  47. Report expression (pro)renin receptors and angiotensin converting enzyme 2/angiotensin-(1-7)/Mas receptor axis in human aortic valve stenosis. PMID: 21316680
  48. the crystal structure of the PRR-IC domain as maltose-binding protein (MBP) fusion proteins at 2.0A (maltose-free) and 2.15A (maltose-bound) was reported. PMID: 21420935
  49. Demonstrate that the (pro)renin receptor (PRR) is expressed in retinal pigment epithelium and may have a role in hypertensive exacerbation of dry age-related macular degeneration. PMID: 19580809
  50. Expression of (pro)renin receptor in human kidneys with end-stage kidney disease due to diabetic nephropathy PMID: 20385187
  51. results reveal an unsuspected role for the prorenin receptor, V-ATPase activity, and acidification during Wnt/beta-catenin signaling PMID: 20093472
  52. expression cloning of the human renin receptor complementary DNA encoding a 350-amino acid protein with a single transmembrane domain and no homology with any known membrane protein PMID: 12045255
  53. specific role for the in cognitive functions and brain development PMID: 15746149
  54. Renin receptor overexpression has resulted in increased intraadrenal angiotensin II, thereby provoking enhanced aldosterone generation in the absence of changes in plasma renin. PMID: 16401765
  55. Human prorenin receptor directly or indirectly contributes to the regulation of renal cortical COX-2 expression. PMID: 16807542
  56. existence of a novel signal transduction pathway involving the ligand renin, renin receptor, and the transcription factor PLZF PMID: 17082479
  57. evidence for the AngII-independent MAPK activation by human (pro)renin receptor and induction of glomerulosclerosis with increased TGF-beta1 expression PMID: 17494887
  58. equal ligand activities of both, renin and prorenin, on the (pro)renin receptor - promyelocytic zinc finger protein-phosphatidylinositol-3 kinase-p85alpha pathway PMID: 18698213
  59. polymorphism of the renin receptor gene is associated with ambulatory blood pressure in Japanese men PMID: 19131936
  60. prorenin, renin and the peptides bind to (P)RR and the decoy reduces prorenin binding, supporting our hypothesis that decoy peptide region has a crucial role in prorenin binding. PMID: 19513539
  61. (Pro)renin receptor may contribute to the generation of arterial angiotensin II in kidney failure patients PMID: 19641301
  62. prospective crucial regions in renin and prorenin responsible for their interaction with the (pro)renin receptor [PRR] were investigated using various kinds of peptides PMID: 19733264

Show More

Hide All

Involvement in disease Mental retardation, X-linked, with epilepsy (MRXE); Parkinsonism with spasticity, X-linked (XPDS)
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Expressed in brain, heart, placenta, liver, kidney and pancreas. Barely detectable in lung and skeletal muscles. In the kidney cortex it is restricted to the mesangium of glomeruli. In the coronary and kidney artery it is expressed in the subendothelium,
Database Links

HGNC: 18305

OMIM: 300423

KEGG: hsa:10159

STRING: 9606.ENSP00000367697

UniGene: Hs.495960

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1