Recombinant Human Repulsive guidance molecule A (RGMA)

In Stock
Code CSB-EP836186HU
Abbreviation Recombinant Human RGMA protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Neuroscience
Alternative Names
Repulsive guidance molecule A; RGM; RGM domain family member A; RGMA; RGMA_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
169-424aa
Target Protein Sequence
PHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAATATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTTIVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPTAPETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYDRTRDLPGRA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.5 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Repulsive guidance molecule A (RGMA) is produced in E. coli and includes the full-length mature protein spanning amino acids 169 to 424. The protein features an N-terminal 10xHis-tag and a C-terminal Myc-tag, which help with purification and detection processes. SDS-PAGE analysis confirms a purity level exceeding 85%, making it appropriate for various research applications.

RGMA belongs to the repulsive guidance molecule family. It appears to play a critical role in axon guidance and neural development. The protein is involved in signaling pathways that may influence neural patterning and regeneration, which has made it a subject of considerable interest in neurobiology research. Understanding RGMA's interactions and functions could provide insights into nervous system development and potential therapeutic approaches for neural repair.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Antibody Development and Validation Studies

This recombinant RGMA protein can work as an immunogen or antigen for developing monoclonal or polyclonal antibodies against human RGMA. The dual tagging system - with its N-terminal His-tag and C-terminal Myc-tag - offers multiple epitopes for antibody validation through Western blot, ELISA, and immunoprecipitation assays. The 85% purity level appears sufficient for immunization protocols and subsequent antibody characterization studies. Researchers can likely use this protein to generate research-grade antibodies for studying RGMA expression and localization across different cell types and tissues.

2. Protein-Protein Interaction Studies

The His-tagged RGMA protein can be immobilized on nickel-affinity matrices for pull-down assays to identify potential binding partners from cell lysates or purified protein libraries. Meanwhile, the Myc-tag allows detection and confirmation of successful protein capture in these interaction studies. This approach may help researchers investigate RGMA's molecular interactions and identify novel binding partners that could be involved in guidance signaling pathways. The expressed region (169-424aa) represents the mature protein form, which suggests it's suitable for physiologically relevant interaction studies.

3. ELISA-Based Binding Assays

Both tags work together to support the development of sandwich or direct ELISA formats for quantitative binding studies. The protein can be coated onto ELISA plates via the His-tag while the Myc-tag serves as a detection epitope using anti-Myc antibodies. This dual-tag system provides flexibility in assay design. It enables researchers to study RGMA binding to various ligands, receptors, or other molecules of interest. The 85% purity is likely adequate for establishing reliable and reproducible ELISA-based assays.

4. Biochemical Characterization and Stability Studies

This recombinant RGMA protein can be used for comprehensive biochemical analysis. This includes molecular weight confirmation, thermal stability assessment, and buffer optimization studies. The defined expression region and dual tagging allow for precise protein identification and tracking during various experimental conditions. Researchers can investigate protein stability under different pH, salt, and temperature conditions to establish optimal storage and handling protocols. These studies may provide fundamental biochemical data necessary for downstream applications and assay development.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Member of the repulsive guidance molecule (RGM) family that performs several functions in the developing and adult nervous system. Regulates cephalic neural tube closure, inhibits neurite outgrowth and cortical neuron branching, and the formation of mature synapses. Binding to its receptor NEO1/neogenin induces activation of RHOA-ROCK1/Rho-kinase signaling pathway through UNC5B-ARHGEF12/LARG-PTK2/FAK1 cascade, leading to collapse of the neuronal growth cone and neurite outgrowth inhibition. Furthermore, RGMA binding to NEO1/neogenin leads to HRAS inactivation by influencing HRAS-PTK2/FAK1-AKT1 pathway. It also functions as a bone morphogenetic protein (BMP) coreceptor that may signal through SMAD1, SMAD5, and SMAD8.
Gene References into Functions
  1. Dysregulation of RGMa plays an important role in the pathology of Parkinson's disease. PMID: 28842419
  2. Thus, we conclude that RGMa inhibits angiogenesis in vitro and in vivo suggesting that its manipulation would be an efficient therapeutic strategy for pro-angiogenic conditions. PMID: 26721439
  3. RGMa expression and promoter methylation status are closely related to colorectal cancer genesis and progression. PMID: 22367090
  4. identification of neogenin-binding site on the repulsive guidance molecule A PMID: 22396795
  5. The expression of RGMA, RGMB and RGMC was evident in most examined prostate cancer cell lines, and also in the prostate cancer tissues PMID: 22076499
  6. Reduced expression of RGMA in breast cancer was associated with breast cancer. PMID: 21617229
  7. The full-length signal peptides of RGMa is functional and furthermore that the C-domains are sufficient and essential for ER targeting, whereas the N-domains are dispensable. Thus, the N-domains are available for additional functions. PMID: 21183991
  8. RGM-A is a unique endogenous inhibitor of leukocyte chemotaxis that limits inflammatory leukocyte traffic PMID: 21467223
  9. Following central nervous system injury, RGM, a novel, potent axonal growth inhibitor, is present in axonal growth impediments: the mature myelin, choroid plexus, and components of the developing scar. PMID: 16216939
  10. RGMa facilitates the use of ActRIIA by endogenous BMP2 and BMP4 ligands that otherwise prefer signaling via BMPRII and increased utilization of ActRIIA leads to generation of an enhanced BMP signal PMID: 17472960
  11. detected a homozygous deletion of chromosomal region 15q26.2 in the cell line HDLM2 encompasing RGMA and CHD2 PMID: 17606441
  12. this study, we show that Unc5B, a member of the netrin receptor family, interacts with neogenin as a coreceptor for RGMa. PMID: 19273616
  13. Frequent inactivation of axon guidance molecule RGMA in human colon cancer through genetic and epigenetic mechanisms. PMID: 19303019

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Repulsive guidance molecule (RGM) family
Database Links

HGNC: 30308

OMIM: 607362

KEGG: hsa:56963

STRING: 9606.ENSP00000452126

UniGene: Hs.271277

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*