Recombinant Human Rho-related GTP-binding protein RhoC (RHOC)

Code CSB-EP019687HU
Abbreviation Recombinant Human RHOC protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
RHOC
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Rho cDNA clone 9
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-190aa
Target Protein Sequence
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRQDEHTRRELAKMKQEPVRSEEGRDMANRISAFGYLECSAKTKEGVREVFEMATRAGLQVRKNKRRRGC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
28.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.259.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Regulates a signal transduction pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Regulates apical junction formation in bronchial epithelial cells.
Gene References into Functions
  1. LncRNA TDRG1 overexpression induced tumor development and RhoC expression. PMID: 28984384
  2. Studied the involvement in epithelial ovarian cancer (EOC) of lncRNA ABHD11-AS1 in and the regulation of EOC by RhoC. PMID: 28818073
  3. YMO1 suppresses tumor invasion and metastasis by inhibiting RhoC activity. PMID: 27487132
  4. this studies show the ability of miR-10b to activate the expression of c-Jun through RhoC and NF1, which represents a novel pathway for promoting migration and invasion of human cancer cells PMID: 27494896
  5. swapping residue 188 identity effectively flips the membrane binding profile of wild-type RhoA and RhoC through positive arginine contribution rather than negative phosphoserine regulation PMID: 27355867
  6. HOTAIR is regulated by the RhoC-MRTF-A-SRF signaling pathway in breast cancer cells. PMID: 28069441
  7. E2F transcription factor 1 (E2F1) downregulated micrRNA miR-519d directly and miR-519d downregulated Ras homolog gene family member C (RhoC) directly. PMID: 28146423
  8. During the process of epithelial-mesenchymal transition in A549 cells induced by TGF-beta1, upregulated RhoC protein and RhoC activity were detected, which was associated with the enhanced invasive capability of the cells in vitro. PMID: 27748883
  9. RhoC downregulation may inhibit the proliferation, drug resistance, invasion and migration of ovarian cancer stem cells. PMID: 27748937
  10. Downregulation of RHOC inhibited cholangiocellular carcinoma cells invasion and migration partially via inhibition of matrix metalloproteinase 2, 3 and 9 expression. RHOC also modulated the expression of several epithelial-mesenchymal transition (EMT)-associated proteins PMID: 27108649
  11. RT-PCR and Western blot assays demonstrated that miR-372 transfection reduced the expression of RhoC. PMID: 26673619
  12. study has identified several new proteins like RHOC, DLG5, UGDH, TMOD3 in addition to known chemoresistance associated proteins in non-small cell lung carcinoma. PMID: 26898345
  13. the oncogene RhoC, a driver of metastatic potential, modulates glutamine and N-acetylaspartate metabolism in Inflammatory Breast Cancer cells in vitro, revealing a novel role for RhoC as a regulator of tumor cell metabolism that extends beyond its well known role in cytoskeletal rearrangement. PMID: 27129239
  14. The knockdown of RhoC protein decreased the proliferation rate of the parental and the IE1-expressing glioblastoma cells. PMID: 26741994
  15. found that miR-10b induced HCC cell invasion and migration by modulating the HOXD10 target gene RhoC, uPAR, MMP-2 and MMP-9 expression PMID: 25236186
  16. Smart particles encapsulating the scrambled siRNA sequence did not affect RhoC protein expression. PMID: 26020100
  17. Depletion of the kinases ROCK1 and ROCK2, two known RhoC downstream effectors, similarly decreases cancer interaction with ECs PMID: 25677806
  18. Results identify RhoC as a prominent binding partner of RhoGDI2 and show that RhoGDI2 modulates RhoC activity in cells promoting lung colonization of bladder cancer cells. PMID: 25516960
  19. Inhibition of ovarian epithelial carcinoma tumorigenesis and progression by miR106b proceeds through the RhoC pathway. PMID: 25933027
  20. MiR-93-5P may inhibit EOC tumorigenesis and progression by targeting RhoC. PMID: 25649143
  21. miR-509 has a critical role in brain metastasis of breast cancer by modulating the RhoC-TNF-alpha network. PMID: 25659578
  22. RhoC protein may upregulate VEGF expression, thereby promoting tumor angiogenesis in esophageal squamous cell carcinoma. PMID: 25624724
  23. This is the first report in HNSCC demonstrating the role RhoC plays in mediating EGF-stimulated migration and invasion by down-regulating the PI3K-Akt pathway and E-cadherin expression. PMID: 25622907
  24. may contribute to an epithelial-mesenchymal transition and drug resistance in human breast cancer during chemotherapy PMID: 25123151
  25. RhoC expression might be involved in epithelial-to-mesenchymal transition of ovarian epithelial carcinoma cells. PMID: 24986540
  26. Down-regulation of RhoC expression resulted in decreased migration of neural stem cells. PMID: 24414340
  27. RhoC has a role in regulating cancer stem cells in head and neck squamous cell carcinoma through the over expression of IL-6 and phosphorylation of STAT3 PMID: 24533098
  28. The S1P2R specifically activates RhoC via G12/13 proteins and LARG. PMID: 23993968
  29. RhoC/ROCK1 signaling pathways are likely involved in the progression of cervical squamous cell carcinoma PMID: 24457551
  30. RhoC facilitates tumor cell invasion and promotes subsequent metastasis, in part, by enhancing integrin alpha5beta1 trafficking PMID: 24312560
  31. The up-regulated RhoC expression may affect ovarian carcinogenesis and should be considered a good biomarker for the differentiation and progression of ovarian carcinoma PMID: 23764197
  32. Increased RHOC expression was detected in endometriotic lesions compared to the eutopic endometrium of women with endometriosis and control women. PMID: 23302395
  33. HBx and HBs of hepatitis B virus could increase expression of Ets-1, which consequently contributed to the upregulation of RhoC. PMID: 23474984
  34. This study demonstrated the role of RhoC overexpression in malignant transformation of normal human hepatocytes, suggesting that RhoC may function as an oncogene in hepatocytes. PMID: 23382905
  35. data suggest that RhoC is a key regulator of cell growth and apoptosis in human hepatocellular carcinoma cells PMID: 21674277
  36. RhoC stimulates the proliferation of gastric cancer cells through recruiting IQGAP1 as an effector. PMID: 23145020
  37. MRK is a novel RhoC effector that controls LPA-stimulated cell invasion at least in part by regulating myosin dynamics, ERK and p38 PMID: 23319595
  38. Increased prostate RhoC expression predicted a good outcome after radical prostatectomy for high-grade prostate cancer. PMID: 22935975
  39. RhoC impacts the metastatic potential and abundance of breast cancer stem cells. PMID: 22911725
  40. Substitution of RhoC Ile 43 with a Val increased guanine nucleotide exchange factors-catalyzed exchange in vitro. PMID: 22673745
  41. Knockdown of Hop caused a decrease in the level of RhoC GTPase, and significantly inhibited pseudopodia formation in Hs578T cells. Our data suggest that Hop regulates directional cell migration by multiple unknown mechanisms. PMID: 23036489
  42. Data demonstrate that PKN3 physically interacts with Rho-family GTPases, and preferentially with RhoC, a known mediator of tumor invasion and metastasis in epithelial cancers. PMID: 22217540
  43. Suggest that miR-10b can stimulate the upregulation of RhoC and AKT phosphorylation through targeting HOXD10, thus promoting cell invasion in gastric tumors. PMID: 22293682
  44. miR-493 is a new tumor suppressor miRNA in bladder cancer and inhibits cell motility through downregulation of RhoC and FZD4. PMID: 22057916
  45. In a signaling cascade, the loss of E-cadherin activates the transcriptional regulator ETS-1 and consequently leads to the induction of RhoC expression that stabilizes c-Jun in melanoma. PMID: 21732343
  46. Expression levels of RhoC and ROCK-1 in prostate carcinoma are higher than those in corresponding paracancerous tissues, showing a significant positive correlation with distant metastasis. PMID: 21575520
  47. p38gamma mitogen-activated protein kinase regulates breast cancer cell motility and metastasis, in part, by controlling expression of the metastasis-associated small GTPase RhoC. PMID: 21862636
  48. RHOC expression was induced by direct p53 binding to a regulatory element within the RHOC gene. PMID: 21079653
  49. The knockdown of RhoC expression had no effect on the migration-stimulatory activity of IQGAP1. PMID: 21537845
  50. RhoC promotes polarized tumor cell migration through FMNL3 by restricting lamellipodial broadening. PMID: 21576392

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cleavage furrow. Note=Translocates to the equatorial region before furrow formation in a ECT2-dependent manner.
Protein Families
Small GTPase superfamily, Rho family
Database Links

HGNC: 669

OMIM: 165380

KEGG: hsa:389

STRING: 9606.ENSP00000285735

UniGene: Hs.502659

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*