Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

RHOG

Uniprot No.

P84095

Research Area

Signal Transduction

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-188aa

Target Protein Sequence

MQSIKCVVVGDGAVGKTCLLICYTTNAFPKEYIPTVFDNYSAQSAVDGRTVNLNLWDTAGQEEYDRLRTLSYPQTNVFVICFSIASPPSYENVRHKWHPEVCHHCPDVPILLVGTKKDLRAQPDTLRRLKEQGQAPITPQQGQALAKQIHAVRYLECSALQQDGVKEVFAEAVRAVLNPTPIKRGRSC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

28.4 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Amino acids 1-188 form the expressed segment for recombinant Human RHOG. The calculated molecular weight for this RHOG protein is 28.4 kDa. This RHOG recombinant protein is manufactured in e.coli. The RHOG gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant RHOG protein during the following stages.

The human Rho-related GTP-binding protein RHOG is a member of the Rho family of small GTPases, playing a pivotal role in regulating cellular processes like cytoskeletal dynamics, cell adhesion, and cell migration. RHOG acts as a molecular switch, cycling between an active GTP-bound state and an inactive GDP-bound state. Upon activation, RHOG interacts with downstream effectors to modulate the organization of the actin cytoskeleton, thereby influencing cell morphology and movement. Its involvement in signaling pathways makes RHOG a key regulator of various cellular functions, and its dysregulation has been associated with diseases such as cancer and immune disorders. Research on RHOG aims to elucidate its specific roles in different cellular contexts, providing insights into potential therapeutic targets.

Target Background

Function

Required for the formation of membrane ruffles during macropinocytosis. Plays a role in cell migration and is required for the formation of cup-like structures during trans-endothelial migration of leukocytes. In case of Salmonella enterica infection, activated by SopB and ARHGEF26/SGEF, which induces cytoskeleton rearrangements and promotes bacterial entry.

Gene References into Functions

High RHOG expression is associated with lung adenocarcinoma. PMID: 29454349
RhoG and SGEF modulate the phosphorylation of paxillin, which plays a key role during invadopodia disassembly. PMID: 28202690
yrosine phosphorylation of SGEF suppresses its interaction with RhoG, the elevation of RhoG activity, and SGEF-mediated promotion of cell migration. We identified tyrosine 530 (Y530), which is located within the Dbl homology domain, as a major phosphorylation site of SGEF by Src, and Y530F mutation blocked the inhibitory effect of Src on SGEF PMID: 27437949
These data suggest a novel link between Tiam1 and RhoG/ILK /ELMO2 pathway as upstream effectors of the Rac1-mediated phagocytic process in trabecular meshwork cells. PMID: 27539661
This study describes the regulation of EMT in RPE cells by TGF-beta1/miR-124/RHOG signaling and suggests that the supplement of miR-124 exogenously would be a valuable therapeutic approach for the prevention or treatment of proliferative vitreoretinopathy. PMID: 26746014
RhoG is expressed and activated in platelets, plays an important role in GPVI-Fc receptor gamma-chain complex-mediated platelet activation, and is critical for thrombus formation in vivo. PMID: 24106269
several Rho family small GTPases activate PI3K by an indirect cooperative positive feedback that required a combination of Rac, CDC42, and RhoG small GTPase activities PMID: 22683270
The invasive capacity of HPV transformed cells requires the hDlg-dependent enhancement of SGEF/RhoG activity. PMID: 22383878
The activation of RhoG recruits its effector ELMO2 and a Rac GEF Dock4 to form a complex with EphA2 at the tips of cortactin-rich protrusions in migrating breast cancer cells. PMID: 20679435
RhoG function is mediated by signals independent of Rac1 and Cdc42 activation and instead by direct utilization of a subset of common effectors PMID: 12376551
we show a novel function for the small GTPase RhoG on the regulation of the interferon-gamma promoter and nuclear factor of activated T cells (NFAT) gene. RhoG also promotes T-cell spreading on fibronectin PMID: 12545154
C-terminal basic tail of RhoG specifically assists the recruitment of the TrioN-PH domain to specific membrane-bound phospholipids PMID: 15199069
Results suggest that RhoG contributes to the regulation of Rac1 activity in migrating cells. PMID: 16339170
RhoG is involved in caveolar trafficking. Such translocation is associated with changes in RhoG GDP/GTP levels and is highly dependent on lipid raft integrity and on the function of the GTPase dynamin2. PMID: 16568096
define RhoG as a critical component of G protein-coupled receptor-stimulated signaling cascades in murine neutrophils PMID: 16621998
Taken together, these results suggest that Dock4 plays an important role in the regulation of cell migration through activation of Rac1, and that RhoG is a key upstream regulator for Dock4. PMID: 17027967
RhoG protects cells from apoptosis caused by the loss of anchorage through a PI3K-dependent mechanism, independent of its activation of Rac1. PMID: 17570359
These results identify a new signaling pathway involving RhoG and its exchange factor SGEF downstream from ICAM1 that is critical for leukocyte trans-endothelial migration. PMID: 17875742
Results suggest that RhoG is a central target of the Yersinia stratagem and a major upstream regulator of Rac1 during different phases of the Yersinia infection cycle. PMID: 19208761

Hide All

Subcellular Location

Cell membrane; Lipid-anchor; Cytoplasmic side.

Protein Families

Small GTPase superfamily, Rho family

Database Links

HGNC: 672

OMIM: 179505

KEGG: hsa:391

STRING: 9606.ENSP00000339467

UniGene: Hs.501728

Code	CSB-EP019690HU
Abbreviation	Recombinant Human RHOG protein
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Rho-related GTP-binding protein RhoG (RHOG)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage