Recombinant Human Rhombotin-1 (LMO1), partial

Code CSB-RP020544h
Abbreviation Recombinant Human LMO1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
LMO1
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
Cysteine rich protein TTG 1; Cysteine rich protein TTG1; Cysteine-rich protein TTG-1; LIM domain only 1; LIM domain only protein 1; LMO 1; LMO-1; lmo1; MGC116692; RBTN 1; RBTN1; RBTN1_HUMAN; RHOM 1; RHOM1; Rhombotin 1; Rhombotin-1; Rhombotin1; T cell translocation protein 1; T-cell translocation protein 1; TTG 1; TTG1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
5-156aa
Target Protein Sequence
DKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAACSKLIPAFEMVMRARDNVYHLDCFACQLCNQRFCVGDKFFLKNNMILCQMDYEEGQLNGTFESQVQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May be involved in gene regulation within neural lineage cells potentially by direct DNA binding or by binding to other transcription factors.
Gene References into Functions
  1. Target genes of the LMO1-regulated microRNAs and their relevant pathways may be a potential therapeutic targe PMID: 30194082
  2. IKZF1 rs10235796 C allele, IKZF1 rs6964969A>G, CDKN2A rs3731246 G>C, and CDKN2A rs3731246 C allele were signi fi cantly associated with Acute Lymphoblastic Leukemia in Yemenis of Arab-Asian descent. Borderline association found in IKZF1 rs4132601 T>G variant. No associations found with LMO1 rs442264; rs3794012; rs4237770 PMID: 28768142
  3. These results suggested that LMO1 gene rs110419 A > G polymorphism may contribute to protection against neuroblastoma PMID: 27009839
  4. A C-to-T single nucleotide transition occurs as a somatic mutation in noncoding sequences 4 kb upstream of the transcriptional start site of the LMO1 oncogene in primary samples from patients with T-cell acute lymphoblastic leukaemia. This conforms to an APOBEC-like cytidine deaminase mutational signature and a new MYB binding site driving high levels of LMO1 expression. PMID: 28260788
  5. LMO1 is an important oncogene that promotes neuroblastoma initiation, progression, and widespread metastatic dissemination. PMID: 28867147
  6. LMO1 appears to be a coactivator of AR involved in the progression of prostate cancer PMID: 26459575
  7. data suggest that genetic variants in LMO1 are associated with increased NB risk in Chinese children. PMID: 26030754
  8. a polymorphism within a super-enhancer element in the first intron of LMO1 influences neuroblastoma susceptibility through differential GATA transcription factor binding and direct modulation of LMO1 expression in cis PMID: 26560027
  9. LMO1 is a commonly activated tumor promoter that activates AKT signaling in non-small cell lung cancer. PMID: 25037573
  10. LMO1 is a commonly activated tumor promoter that activates AKT signaling in colorectal cancer and a new predictive marker for targeted therapy. PMID: 24845030
  11. results show that LMO1 is poised for expression in normal progenitors, where activation of SCL/TAL1 together with a breakdown of epigenetic repression of LMO1 regulatory elements PMID: 23302769
  12. genetic variants within LMO1 are associated with acute lymphoblastic leukemia and identify this gene as a strong candidate for precursor B-cell leukemogenesis. PMID: 21602560
  13. data show that common polymorphisms at the LMO1 locus are strongly associated with susceptibility to developing neuroblastoma, but also may influence the likelihood of further somatic alterations at this locus, leading to malignant progression PMID: 21124317
  14. 60% of transgenic mice that overexpressed both OLIG2 and LMO1 developed pre-T lymphoblastic lymphoma/leukemia with large thymic tumor masses. PMID: 16103065
  15. The present data suggest that TGF-beta, LMO1, possibly RUNX3, and GSDM form a regulatory pathway for directing the pit cells to apoptosis. PMID: 17471240

Show More

Hide All

Involvement in disease
A chromosomal aberration involving LMO1 may be a cause of a form of T-cell acute lymphoblastic leukemia (T-ALL). Translocation t(11,14)(p15;q11) with TCRD.
Subcellular Location
Nucleus.
Tissue Specificity
Expressed mainly in the central nervous. Low level of expression in other tissues including thymus.
Database Links

HGNC: 6641

OMIM: 186921

KEGG: hsa:4004

STRING: 9606.ENSP00000338207

UniGene: Hs.654426

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*