Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

RNASE7

Uniprot No.

Q9H1E1

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

(RNase 7)(Skin-derived antimicrobial protein 2)(SAP-2)

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

29-156aa

Target Protein Sequence

KPKGMTSSQWFKIQHMQPSPQACNSAMKNINKHTKRCKDLNTFLHEPFSSVAATCQTPKIACKNGDKNCHQSHGAVSLTMCKLTSGKHPNCRYKEKRQNKSYVVACKPPQKKDSQQFHLVPVHLDRVL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression of recombinant Human RNASE7 protein involves transfecting e.coli cells with a DNA expression vector carrying the gene for the protein of interest (29-156aa). After transfection, the cells are cultured to produce the desired protein. A N-terminal 6xHis tag is fused to the protein. The recombinant Human RNASE7 protein is collected and purified from the cell lysate through affinity purification, attaining a purity greater than 85%, as determined by SDS-PAGE.

Target Background

Function

Exhibits a potent RNase activity. Has broad-spectrum antimicrobial activity against many pathogenic microorganisms and remarkably potent activity (lethal dose of 90% < 30 nM) against a vancomycin resistant Enterococcus faecium. Causes loss of bacterial membrane integrity. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity.

Gene References into Functions

These data suggest that the induction of RNase 7 in response to Mycobacterium tuberculosis could have a role in anti-mycobacterial immunity. PMID: 29346642
RNase 7 has immunomodulatory functions on TH2 cells and decreases the production of TH2 cytokines in the skin. PMID: 28378334
Our results indicate that RNase 7 is an important factor released by keratinocytes to control the growth of P. aeruginosa on the skin surface. PMID: 27513608
Insulin and PI3K/AKT signaling are essential for RNase 7 expression and increased infection risks in diabetic patients may be secondary to suppressed RNase 7 production. PMID: 27401534
This article provides an overview about the role of RNase 7 in cutaneous defense with focus on the molecular mechanism of the antimicrobial activity of RNase 7, the regulation of RNase 7 expression, and the role of RNase 7 in skin diseases. [review] PMID: 27089327
RNH1 bound to RNase 7 and suppressed its antimicrobial activity by blocking its ability to bind the cell wall of uropathogenic bacteria. PMID: 24107847
RNase 7 is an antimicrobial protein that plays an important role in the innate immune defense system of human epithelia. PMID: 12244054
Suggest that RNase 7 may function as antimicrobial peptide with a role in the differentiation and development of the primitive epidermis. PMID: 23545750
the influence of STAT3 on the IL-17A/IFN-gamma -mediated RNase 7 induction PMID: 23555696
RNase 7 expression is increased in the urinary tract with infection and has antibacterial activity against uropathogens at micromolar concentrations. PMID: 23302724
a complex relationship between tear induction of miR-762, its modulation of innate defense genes, and P. aeruginosa internalization PMID: 23469087
RNASE7 prevents staphylococcal skin infections PMID: 20668470
proteases contribute indirectly to the defense function of the stratum corneum by releasing the RNase inhibitor mediated inhibition of RNase 5 and RNase 7. PMID: 19262607
Using phospholipid vesicles as membrane models, RNase 3 triggers first the vesicle aggregation, while RNase 7 induces leakage well before the aggregation step. PMID: 19366593
data indicate that RNase 7 contributes to the E. faecium-killing activity of skin extracts and suggest an important role for RNase 7 in the protection of human skin against E. faecium colonization PMID: 19641608
These findings suggest that antimicrobial peptides found at high baseline levels in healthy skin, such as RNase 7, confer protection against Staphylococcus aureus infection of the skin. PMID: 19919305

Hide All

Subcellular Location

Secreted.

Protein Families

Pancreatic ribonuclease family

Tissue Specificity

Expressed in collecting ducts in kidney, and in apical uroepithelium in bladder (at protein level). Expressed in various epithelial tissues including skin, respiratory tract, genito-urinary tract and, at a low level, in the gut. Expressed in liver, kidney

Database Links

HGNC: 19278

OMIM: 612484

KEGG: hsa:84659

STRING: 9606.ENSP00000298690

UniGene: Hs.525206

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP872431HU
Abbreviation	Recombinant Human RNASE7 protein
MSDS	MSDS Datasheet
Size	$306
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Ribonuclease 7 (RNASE7)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage