Name: Recombinant Human Scrapie-responsive protein 1 (SCRG1)
Brand: CUSABIO
SKU: CSB-EP530448HUa0

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

SCRG1

Uniprot No.

O75711

Research Area

Neuroscience

Alternative Names

AW124307; Scrapie-responsive gene 1 protein; Scrapie-responsive protein 1; SCRG 1; ScRG-1; Scrg1; SCRG1_HUMAN; UNQ390/PRO725

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

21-98aa

Target Protein Sequence

MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

12.9 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CUSABIO used E.coli cells to express N-terminal 6xHis-SUMO-tagged human Scrapie-responsive protein 1 (Scrg1). This recombinant Scrg1 protein is full-length of mature protein containing 21-98aa of mouse Scrg1. Its purity reached up to 90% measured by SDS-PAGE. Under reducing conditions, a molecular weight band of around 14-16 kDa was visualized on the gel. Not only being an immunogen for specific antibody production, but this recombinant Scrg1 protein may also be used in the studies of Scrg1-related signal transduction.

Scrg1 is a transcription factor that promotes chondrogenic gene expression. Human Scrg1 participates in self-renewal, migration, osteogenic differentiation, and chondrogenic differentiation of mesenchymal stem cells (MSCs) by maintaining the expression of octamer-binding transcription factor 4 (Oct-4) and CD271/low-affinity nerve growth factor receptor (LNGFR). In MSCs, Scrg1 promotes cell migration through the β1 integrin/focal adhesion kinase (FAK) -dependent PI3K/Akt pathway. Manabu Inoue etc. Scrg1 inhibits LPS-induced chemokine CCL22 expression through the activation of the ERK1/2 signaling pathway in mouse macrophage Raw264.7 cells.

Target Background

Gene References into Functions

Novel SCRG1/BST1 axis regulates self-renewal, migration, and osteogenic differentiation potential in mesenchymal stem cells. PMID: 24413464
Aomatsu et al. identified a novel SCRG1/BST1 (CD157) ligand-receptor combination that maintains human mesenchymal stem cells expressions of stem cell markers Oct-4 and CD271 (LNGFR), as well as self-renewal, migration, and osteogenic differentiation potentials during ex vivo expansion. PMID: 24413464

Subcellular Location

Secreted.

Protein Families

SCRG1 family

Tissue Specificity

Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.

Database Links

HGNC: 17036

OMIM: 603163

KEGG: hsa:11341

STRING: 9606.ENSP00000296506

UniGene: Hs.7122

Code	CSB-EP530448HUa0
Abbreviation	Recombinant Human SCRG1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Scrapie-responsive protein 1 (SCRG1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage