Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
AW124307; Scrapie-responsive gene 1 protein; Scrapie-responsive protein 1; SCRG 1; ScRG-1; Scrg1; SCRG1_HUMAN; UNQ390/PRO725
Species
Homo sapiens (Human)
Expression Region
21-98aa
Target Protein Sequence
MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
CUSABIO used E.coli cells to express N-terminal 6xHis-SUMO-tagged human Scrapie-responsive protein 1 (Scrg1). This recombinant Scrg1 protein is full-length of mature protein containing 21-98aa of mouse Scrg1. Its purity reached up to 90% measured by SDS-PAGE. Under reducing conditions, a molecular weight band of around 14-16 kDa was visualized on the gel. Not only being an immunogen for specific antibody production, but this recombinant Scrg1 protein may also be used in the studies of Scrg1-related signal transduction.
Scrg1 is a transcription factor that promotes chondrogenic gene expression. Human Scrg1 participates in self-renewal, migration, osteogenic differentiation, and chondrogenic differentiation of mesenchymal stem cells (MSCs) by maintaining the expression of octamer-binding transcription factor 4 (Oct-4) and CD271/low-affinity nerve growth factor receptor (LNGFR). In MSCs, Scrg1 promotes cell migration through the β1 integrin/focal adhesion kinase (FAK) -dependent PI3K/Akt pathway. Manabu Inoue etc. Scrg1 inhibits LPS-induced chemokine CCL22 expression through the activation of the ERK1/2 signaling pathway in mouse macrophage Raw264.7 cells.
