Recombinant Human Scrapie-responsive protein 1(SCRG1)

In Stock
Code CSB-EP530448HUa0
Product Type Recombinant Protein
Size US$1726
Uniprot No. O75711
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ
Research Area Neuroscience
Source E.coli
Gene Names SCRG1
Protein Names Scrapie-responsive gene 1 protein ;ScRG-1
Expression Region 21-98aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 12.9 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families SCRG1 family
Tissue Specificity Expressed abundantly in the central nervous system of adult, but not at all in fetal brain. High levels of SCRG1 transcripts are also observed in testis and aorta.
Database Links

HGNC: 17036

OMIM: 603163

KEGG: hsa:11341

STRING: 9606.ENSP00000296506

UniGene: Hs.7122

Related Products

SCRG1 Antibodies

SCRG1 Antibodies for Human

SCRG1 Proteins

SCRG1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.