Recombinant Human Semenogelin-1(SEMG1)

In Stock
Code CSB-EP021001HU
Size US$1726Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names SEMG1
Uniprot No. P04279
Research Area Cell Biology
Alternative Names Alpha-Inhibin-31; Alpha-Inhibin-92; Cancer/testis antigen 103; CT103; dJ172H20.2 (semenogelin I); dJ172H20.2; MGC14719; Semen coagulating protein; Semenogelin; Semenogelin I; SEMG; SEMG1; SEMG1_HUMAN; Seminal basic protein; seminal vesicle secretory protein 5; SgI; Svp-1; Svp5; SVPIIA; Svs2; SVS2P; Svs2p2; Svs5
Species Homo sapiens (Human)
Source E.coli
Expression Region 24-402aa
Target Protein Sequence QKGGSKGRLPSEFSQFPHGQKGQHYSGQKGKQQTESKGSFSIQYTYHVDANDHDQSRKSQQYDLNALHKTTKSQRHLGGSQQLLHNKQEGRDHDKSKGHFHRVVIHHKGGKAHRGTQNPSQDQGNSPSGKGISSQYSNTEERLWVHGLSKEQTSVSGAQKGRKQGGSQSSYVLQTEELVANKQQRETKNSHQNKGHYQNVVEVREEHSSKVQTSLCPAHQDKLQHGSKDIFSTQDELLVYNKNQHQTKNLNQDQQHGRKANKISYQSSSTEERRLHYGENGVQKDVSQRSIYSQTEKLVAGKSQIQAPNPKQEPWHGENAKGESGQSTNREQDLLSHEQKGRHQHGSHGGLDIVIIEQEDDSDRHLAQHLNNDRNPLFT
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 58.8kDa
Protein Length Full Length of Mature Protein
Tag Info N-terminal 6xHis-SUMO-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Predominant protein in semen. It participates in the formation of a gel matrix entrapping the accessory gland secretions and ejaculated spermatozoa. Fragments of semenogelin and/or fragments of the related proteins may contribute to the activation of progressive sperm movements as the gel-forming proteins are fragmented by KLK3/PSA.
Gene References into Functions
  1. Data indicate that semenogelin I (Sg I) expression has potential value in predicting renal cell carcinoma (RCC) progression and prognosis, suggesting the use of Sg I as a biomarker for RCC. PMID: 25027395
  2. Peptides from the antimicrobial protein semenogelin I have antibacterial activity. PMID: 18314226
  3. EPPIN and SEMG1 rapidly co-evolved in primates PMID: 24312623
  4. SEMG1 was significantly changed in asthenozoosperm, which could be the candidate gene for the development of diagnostic marker and provided the opportunity to further illustrate the biological mechanisms of asthenozoospermia. PMID: 23289976
  5. Three regions of SEM1(86-107) comprise the amyloid fibril core that enhances HIV-1 infection. PMID: 24811874
  6. Interaction analysis identifies semenogelin I fragments as new binding partners of PIP in human seminal plasma PMID: 23085372
  7. EPPIN's semenogelin I binding site: a contraceptive drug target. PMID: 22699487
  8. Nuclear semenogelin I expression could be a reliable prognosticator in men who undergo radical prostatectomy. PMID: 22617231
  9. The proteomes of the type-1 diabetic, type-2 diabetic, and non-diabetic obese patients presented elevated amounts of the same set of one molecular form of semenogelin-1, one form of clusterin, and two forms of lactotransferrin. PMID: 21525168
  10. Peptides released by physiological cleavage of Semg1 and Semg2 form amyloids that enhance HIV infection. PMID: 22177559
  11. These results suggest the involvement of semenogelins in prostate cancer and their prognostic values in predicting cancer progression after radical prostatectomy. PMID: 21557275
  12. Spermatozoa interact with semenogelin I in solution in a non-Zn2+-dependent manner, but associate with immobilized semenogelin I only in the presence of Zn2+. PMID: 20378931
  13. Cysteine 239 of rSEMG1 appears to be the critical amino acid for both binding to eppin and inhibiting sperm motility. PMID: 19889947
  14. Transcripts in the gastro-intestinal tract and skeletal muscle almost exclusively encoded SgI PMID: 12200457
  15. Seminal plasma motility inhibitor, one of the fragments of Sg, has its inhibitory effect on ejaculated spermatozoa in liquefied semen under physiological conditions. PMID: 14581514
  16. peptides produced by cleavage of semenogelin I, the predominant human semen coagulum protein, had high levels of antibacterial activity. PMID: 14613901
  17. structural changes in the semenogelin 1 and 2 proteins that have arisen since the human-chimpanzee-gorilla split may be responsible for the physiological differences between these species ejaculated semen that correlate with their sociosexual behavior PMID: 14629036
  18. The binding of Zn2+ to SgI and SgII and their involvment in regulating the activity of PSA are reported. PMID: 15563730
  19. in seminal plasma and on spermatozoa following ejaculation, Eppin is bound to semenogelin I PMID: 15590901
  20. Authors analyzed an intronic T9 repeat of semenogelin I (SEMG1) and report mutation frequencies of 51% (75 of 146) and 62% (8 of 13) in MMR-deficient primary colorectal cancers and cell lines, respectively. PMID: 15930278
  21. The study provides evidence that senile seminal vesicle amyloid is derived from SgI; this form of amyloidosis was provisionally designated as ASgI. PMID: 15962837
  22. truncated (lacking 60 amino acids ) & wild-type semenogelin molecules had similar Zn(2+)-binding properties & they showed also similar susceptibility for degradation by prostate-specific antigen PMID: 16582407
  23. The semenogelin-CD52 soluble form is a direct consequence of the liquefaction process in human semen. PMID: 17624925
  24. The conformational change induced in semenogelin I by the binding of Zn(2+) may contribute to the ability of this protein to form a gel PMID: 17680810
  25. SGI is a novel target for protein S-nitrosylation in spermatozoa. PMID: 17683036
  26. SEMG I expression in myeloma cells can be upregulated by 5-azacytidine, IL-4 and IL-6. PMID: 18468680
  27. semenogelins I and II were directly cleaved by KLK14. Semenogelins were also able to reverse KLK14 inhibition by Zn2+, providing a novel regulatory mechanism for KLK14 activity. PMID: 18482984
  28. antibacterial activity of the semenogelin-derived peptides generated in seminal plasma was strictly zinc-dependent both at neutral and low pH PMID: 18714013
  29. Semenogelins (Sgs) modifies the membrane structure, indirectly inhibiting motility, and provides suggestions for a therapy for male infertility through selection of a functional sperm population using Sgs. PMID: 19089943
  30. expressed in 46% of patients with early stage chronic lymphocytic leukemia; potential target for cancer vaccines PMID: 19241194

Show More

Hide All

Subcellular Location Secreted
Protein Families Semenogelin family
Tissue Specificity Seminal vesicle.
Database Links

HGNC: 10742

OMIM: 182140

KEGG: hsa:6406

STRING: 9606.ENSP00000361867

UniGene: Hs.1968

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1