Recombinant Human Serine protease inhibitor Kazal-type 1 (SPINK1), partial

In Stock
Code CSB-EP022575HU1
Abbreviation Recombinant Human SPINK1 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
SPINK1
Uniprot No.
Research Area
Cell Biology
Alternative Names
Pancreatic secretory trypsin inhibitor;Tumor-associated trypsin inhibitor;TATI
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
19-79aa
Target Protein Sequence
GNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine protease inhibitor which exhibits anti-trypsin activity. In the pancreas, protects against trypsin-catalyzed premature activation of zymogens.; In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production.
Gene References into Functions
  1. 3 siblings with near identical clinical manifestations of early onset acute recurrent pancreatitis (ARP), all possessing the same heterozygous for serine protease inhibitor, Kazal type 1 (SPINK1) mutation c.55+1G>A. PMID: 29346218
  2. We demonstrate for the first time a significant decrease of SPINK1 levels after surgical decompression of pancreatic duct and a reduction of trypsin activity analysis after endoscopic decompression PMID: 29525377
  3. SPINK1 over expression is associated with prostate cancer specific mortality in at risk men with biochemical and clinical recurrence after prostatectomy PMID: 27238617
  4. Data show that alteration in beta-catenin expression, a core component of the CDH17/beta-catenin axis, in tumors affects serine peptidase inhibitor Kazal type 1 (SPINK1) serum levels in hepatocellular carcinoma (HCC) patients. PMID: 28631187
  5. Findings indicate that the serine protease inhibitor, Kazal type 1 (SPINK1) p.N34S allele may cause reduced SPINK1 expression. PMID: 28609377
  6. Having correlated our findings with current knowledge of SPINK1's role in exocrine pancreas pathophysiology, we propose that complete and partial functional losses of the SPINK1 gene are associated with quite distinct phenotypes, the former causing a new pediatric disease entity of severe infantile isolated exocrine pancreatic insufficiency (EPI) . PMID: 28945313
  7. results suggest that rs142703147:C>A, which disrupts a PTF1L-binding site within an evolutionarily conserved HNF1A-PTF1L cis-regulatory module located upstream of the SPINK1 promoter, contributes to the chronic pancreatitis risk haplotype. PMID: 28556356
  8. Studied mutations in cationic trypsinogen (PRSS1) and serine protease inhibitor Kazal type 1 (SPINK1) and their association with alcoholic chronic pancreatitis (ACP) and idiopathic chronic pancreatitis. PMID: 29641165
  9. Studies indicate that serine peptidase inhibitor Kazal type 1 (SPINK1) gene, particularly the N34S mutation, has a genetic association with the development of pancreatitis [Meta-analysis]. PMID: 28984793
  10. association between SPINK1 p.N34S gene variation and chronic pancreatitis [review, meta-analysis] PMID: 28546062
  11. We present the case of a child with a homozygous mutation N34S in the SPINK1 gene, leading to acute recurrent pancreatitis and ultimately to chronic pancreatitis PMID: 28229614
  12. Used in silico splicing prediction programs to prioritize SPINK1 intronic variants for further quantitative RT-PCR analysis the non-pathological c.194 + 13T > G variant was predicted by different programs to generate a new & viable donor splice site, the prediction scores being comparable to those for the physiological c.194 + 2T donor splice site & even higher than those for the physiological c.87 + 1G donor splice site. PMID: 28472998
  13. Gene mutations were present in PRSS1 in 26 patients with acute recurrent and chronic pancreatitis, SPINK1 in 23, CTRC in 3, and CPA1 in 5. In the 31 patients with mutations in SPINK1, CTRC, or CPA1, 16 (51.6%) had homozygous or heterozygous mutations with other mutations. PMID: 27409067
  14. SPINK1 can associate with EGFR to promote the expression of cell proliferation-related and anti-apoptosis-related genes/proteins; inhibit the expression of pro-apoptosis-related genes/proteins via p38, ERK, and JNK pathways; and consequently promote the proliferation of BRL-3A cells. PMID: 28845526
  15. The present study demonstrates for the first time that both fibroblast-derived and recombinant IL-6 induces SPINK1 expression and secretion in in colorectal adenocarcinoma. PMID: 26663388
  16. Absolute exclusivity between SPINK1 overexpression and homozygous PTEN deletion in localized PCA. PMID: 27738792
  17. It is the first time to simultaneously detect SPINK1 and ERG expression in initially diagnosed bone metastatic prostate cancer. The over-expression of SPINK1 was not only related to poor PSA response, but also significantly associated with the occurrence of castration-resistant prostate cancer, especially in those with much more aggressive phenotype PMID: 27159572
  18. We describe a case of malignant pancreatic cancer diagnosed in a young patient with chronic pancreatitis who is a SPINK 1 heterozygote gene mutation carrier PMID: 27358244
  19. Mutations in CFTR, SPINK1 or PRSS1 are present in one third of pediatric acute recurrent (ARP) or chronic (CP) pancreatitis with no other cause. PMID: 26692446
  20. TATI proved to be a sensitive indicator of disease recurrence and distant metastasis, with a sensitivity of 84.4% and 75.7%, respectively. PMID: 26350184
  21. Sixteen patients exhibited heterozygous pathogenic variants of SPINK1, including c.194+2T>C (n=12), p.N34S (n=3), and a novel pathogenic splicing variation c.194+1G>A. PMID: 27578509
  22. Data indicate that SPINK1 expression status shows a lower rate of concordance between primary prostate cancer (PCA) site and nodule metastases, than those of ERG and PTEN. PMID: 26725250
  23. Approx 25% of discontinuously involved prostate biopsy cores showed tumor foci with discordant ERG/SPINK1 status, consistent with multiclonal disease. PMID: 26743468
  24. Letter/Case Report: high penetrance of the PRSS1 A16V mutation caused by SPINK1 N34S and CFTR TG11-5T co-mutations associated with pancreatitis. PMID: 26658045
  25. Identify SPINK1 promoter variants exhibiting significant functional defects that should be considered potential risk factors for chronic pancreatitis. PMID: 26348468
  26. expression represents an independent prognostic factor for poor survival in ovarian carcinoma patients PMID: 26437224
  27. The SPINK1 protein seems to play a role in tumor proliferation. PMID: 26037168
  28. neither ERG nor SPINK1 appear to be useful biomarkers for prognostication of early stage prostate cancer PMID: 26172920
  29. The majority of children with genetic predisposition to idiopathic acute and acute recurrent pancreatitis have the SPINK1 mutation. PMID: 25981744
  30. Patients with SPINK1 N34S mutations were more likely to develop a Dilated duct, Calcifications, and Diabetes as Long-term Outcome of Endoscopic Treatments in Idiopathic Chronic Pancreatitis. PMID: 26632706
  31. Evidence suggests that SPINK1 is an important growth factor that connects chronic inflammation and cancer. PMID: 25804623
  32. Over-expression of FOXP1 and SPINK1 may participate in the carcinogenesis of hepatitis B virus related cirrhosis. PMID: 26054682
  33. SPINK1 plays a role as a growth factor, signaling through the EGFR pathway in pancreatic ductal adenocarcinoma and neoplasms, and that the EGFR is involved in the malignant transformation of IPMN. PMID: 23475261
  34. In Israel, pediatric as well as adult recurrent acute pancreatitis and chronic pancreatitis are often associated with cationic trypsinogen, SPINK1, chymotrypsin C, or Cystic Fibrosis Transmembrane Conductance Regulator mutations. PMID: 25383785
  35. Mutation p.N34S in SPINK1 may predispose patients to acute pancreatitis, especially in those abusing alcohol, and may promote a more severe course of the disease. PMID: 26100556
  36. This study shows that PRSS1, SPINK1 and CFTR mutations do not play a role in alcoholic and idiopathic chronic pancreatitis patients. PMID: 25835118
  37. no mutation associated with pancreatitis PMID: 26376395
  38. OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC PMID: 25862856
  39. SPINK1 promoter variants are likely to be associated with the risk of BPH. PMID: 26124326
  40. These data highlight the importance of SPINK1/TATI as a tumor marker for HCV-induced HCC and may lead to a better understanding of HCV-induced hepatocarcinogenesis. PMID: 25531719
  41. Our results suggest that SPINK1 protein expression may not be a predictor of recurrence or lethal prostate cancer amongst men treated by radical prostatectomy PMID: 24687926
  42. One novel SPINK1 mutation was identified in Mexican patients with early onset idiopathic recurrent acute pancreatitis. PMID: 25206283
  43. Results suggest that sequence evaluation of the SPINK1 promoter region in patients with chronic pancreatitis is justified as part of the etiological investigation. PMID: 25792561
  44. ERG and TFF3 expression characterize 2 distinct subsets of prostate cancer, with a more aggressive subgroup of TFF3-expressing tumors that express SPINK1. PMID: 25639219
  45. The p.N34S mutation in SPINK1 gene was found more frequently in patients with AP in the Indian population, irrespective of disease etiology and whether the disease was recurrent or not, and with earlier age of onset. PMID: 24844923
  46. The SPINK1 mutation frequency was significantly decreased in patients with pancreatic cancer in comparison with patients with idiopathic pancreatitis but varied not significantly in comparison with healthy controls. PMID: 25003218
  47. study found a significant association of SPINK1 (N34S) gene polymorphism with chronic pancreatitis PMID: 24616641
  48. An association between strong claudin-5 expression and higher serum levels of TATI (p=0.04) and CA125 (p=0.008) were found PMID: 25667483
  49. Over-expression of TATI predicts an unfavorable outcome in several cancers and serum TATI can be used to identify patients at increased risk of aggressive disease--{REVIEW} PMID: 24583226
  50. Data indicate epidermal growth factor receptor (EGFR)+/tumor-associated trypsinogen inhibitor (TATI)+ patients showed better survival. PMID: 24204699

Show More

Hide All

Involvement in disease
Pancreatitis, hereditary (PCTT); Tropical calcific pancreatitis (TCP)
Subcellular Location
Secreted.
Database Links

HGNC: 11244

OMIM: 167790

KEGG: hsa:6690

STRING: 9606.ENSP00000296695

UniGene: Hs.407856

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*