Recombinant Human Short transient receptor potential channel 1 (TRPC1)

Code CSB-YP025075HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025075HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP025075HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP025075HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP025075HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
TRPC1
Uniprot No.
Alternative Names
HTRP 1; HTRP1; MGC133334; MGC133335; Mtrp1; Short transient receptor potential channel 1; Transient receptor potential canonical 1; Transient receptor potential cation channel subfamily C member 1; Transient receptor potential channel 1; Transient receptor protein 1; TRP 1; TRP 1 protein; Trp related protein 1; TRP-1; TRP1; TRP1 protein; TrpC1; Trpc1 transient receptor potential cation channel subfamily C member 1; TRPC1_HUMAN; Trrp1
Species
Homo sapiens (Human)
Expression Region
1-793
Target Protein Sequence
MMAALYPSTDLSGASSSSLPSSPSSSSPNEVMALKDVREVKEENTLNEKLFLLACDKGDY YMVKKILEENSSGDLNINCVDVLGRNAVTITIENENLDILQLLLDYGCQSADALLVAIDS EVVGAVDILLNHRPKRSSRPTIVKLMERIQNPEYSTTMDVAPVILAAHRNNYEILTMLLK QDVSLPKPHAVGCECTLCSAKNKKDSLRHSRFRLDIYRCLASPALIMLTEEDPILRAFEL SADLKELSLVEVEFRNDYEELARQCKMFAKDLLAQARNSRELEVILNHTSSDEPLDKRGL LEERMNLSRLKLAIKYNQKEFVSQSNCQQFLNTVWFGQMSGYRRKPTCKKIMTVLTVGIF WPVLSLCYLIAPKSQFGRIIHTPFMKFIIHGASYFTFLLLLNLYSLVYNEDKKNTMGPAL ERIDYLLILWIIGMIWSDIKRLWYEGLEDFLEESRNQLSFVMNSLYLATFALKVVAHNKF HDFADRKDWDAFHPTLVAEGLFAFANVLSYLRLFFMYTTSSILGPLQISMGQMLQDFGKF LGMFLLVLFSFTIGLTQLYDKGYTSKEQKDCVGIFCEQQSNDTFHSFIGTCFALFWYIFS LAHVAIFVTRFSYGEELQSFVGAVIVGTYNVVVVIVLTKLLVAMLHKSFQLIANHEDKEW KFARAKLWLSYFDDKCTLPPPFNIIPSPKTICYMISSLSKWICSHTSKGKVKRQNSLKEW RNLKQKRDENYQKVMCCLVHRYLTSMRQKMQSTDQATVENLNELRQDLSKFRNEIRDLLG FRTSKYAMFYPRN
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thought to form a receptor-activated non-selective calcium permeant cation channel. Probably is operated by a phosphatidylinositol second messenger system activated by receptor tyrosine kinases or G-protein coupled receptors. Seems to be also activated by intracellular calcium store depletion.
Gene References into Functions
  1. these results suggest that dopaminergic neurotoxins initially decreased Ca(2+) entry, which inhibited the binding of NF-kappaB to the TRPC1 promoter, thereby inhibiting TRPC1 expression and resulting in cell death by preventing autophagy. PMID: 29150520
  2. TRPC1 regulated HIF1alpha levels in PTEN-deficient MDA-MB-468 and HCC1569 breast cancer cell lines. This regulation arises from effects on the constitutive translation of HIF1alpha under normoxic conditions via an Akt-dependent pathway. PMID: 28559303
  3. Store-operated calcium entry (SOCE), a unique plasma membrane Ca(2+) entry mechanism, is activated when ER-[Ca(2+)] is decreased. SOCE is mediated via the primary channel, Orai1, as well as others such as TRPC1. PMID: 29594865
  4. the role of TRPC1 in the development of podocyte injury and disorders of the podocyte cytoskeleton, which may contribute to the development of novel therapeutics for podocyte injury-associated kidney diseases. PMID: 28949388
  5. TRPC1 is a primary candidate in forming SOCC that stimulates CaSRinduced SOCE and NO production in HUVECs PMID: 28791397
  6. role in the odontoblast-like differentiation of dental pulp cells PMID: 28041683
  7. Data show that RNAi-mediated knockdown of KCa3.1 and/or TRPC1 leads to a significant decrease in cell proliferation due to cell cycle arrest in the G1 phase PMID: 27183905
  8. Data indicate that the inhibition of the Store Operated Calcium Entry (SOCE)-dependent colon cancer cell migration through SK3/TRPC1/Orai1 channel complex by the alkyl-lipid Ohmline may be a strategy to modulate Anti-EGFR mAb action in metastatic colorectal cancer (mCRC). PMID: 27102434
  9. These observations suggest that mechanical stretch may induce an influx of Ca(2+) and up-regulation of IL-13 and MMP-9 expression in 16HBE cells via activation of TRPC1 PMID: 27986325
  10. These findings suggest identification of an important experimental tool compound, which has much higher potency for inhibiting TRPC1/4/5 channels than previously reported agents, impressive specificity, and graded subtype selectivity within the TRPC1/4/5 channel family. PMID: 28325835
  11. changes in cell cycle regulating genes in TRPC1-silenced cells indicate possible cell cycle arrest along with compensatory up-regulation of ERBB3 growth factor receptor-amongst others-to maintain hepatocellular carcinoma cell proliferation. PMID: 27443843
  12. OC. Our results provide the basis for further investigations of the drug-resistance-related functions of TRPC1 in ovarian cancer and other forms of cancer. PMID: 26647723
  13. TRPC1 mRNA and protein levels were increased in FCDIa, FCDIIa, and FCDIIb patients. PMID: 26280213
  14. HIF-1alpha knockdown attenuated hypoxia-induced BMP4 expression and knockdown of either HIF-1alpha or BMP4 abolished hypoxia-induced TRPC expression and basal [Ca(2+)]i. PMID: 25824146
  15. In c-kit+ cardiac progenitor cells, silencing TRPC1 significantly reduced the Ca2+ signaling through store-operated Ca2+ channels, decreased cell proliferation and migration, and reduced expression of cyclin D1, cyclin E, and/or p-Akt. PMID: 26453325
  16. RhoA interacts with and activates TRPC1 and thus stimulates rapid epithelial restitution after injury by inducing Ca(2+) signaling. PMID: 26336927
  17. TRPC1 may take part both in regulation of store-operated Ca(2+) entry and proliferation of hepatocellular carcinoma cells. PMID: 25960236
  18. The decrease in mitochondrial Ca(2+) loading following CPA-induced endoplasmic reticulum depletion in TRPC1-silenced Huh7 cells suggests a possible role of TRPC1 in hepatocellular carcinoma cell apoptosis. PMID: 25535724
  19. TRPC1 functions as a major regulator of S1P3 and VEGFR2 expression. PMID: 25971967
  20. The present study revealed that 11,12-EET targets the TRPV4-TRPC1-KCa1.1 complex to induce smooth muscle cell hyperpolarization and vascular relaxation in human LIMAs. PMID: 25511389
  21. Our results suggest that IFC detects changes in whole-cell membrane organization associated with TRPC1 activation and surface expression, rather than cation permeation through the channel per se PMID: 24639248
  22. TRPV4, TRPC1, and TRPP2 contribute to the ion permeation pore of the channels. PMID: 25114176
  23. A role for TRPC1 as an integral component of store-operated calcium entry was identified. PMID: 25133583
  24. the reciprocal shift in transient receptor potential channel 1 (TRPC1) and stromal interaction molecule 2 (STIM2) contributes to Ca2+ remodeling and cancer hallmarks in colorectal carcinoma cells PMID: 25143380
  25. TRPC1 is involved in the cytotoxicity and entry of Pb(2+) through molecular interactions with STIM1 and subsequent Ca(2+) influx PMID: 24953315
  26. The Cl(-) channels could be an important downstream target of TRPC1 in many other cells types, coupling elevations in [Ca(2+)]i to the shape and volume changes associated with migrating cells. PMID: 23261316
  27. TRPC1 polymorphisms are associated with type 1 and type 2 diabetes mellitus in the Han Chinese population. PMID: 23544998
  28. the enhanced apoptosis caused by the simultaneous depletion of Dp53 and Dmp52 is absolutely JNK-dependent. PMID: 23549783
  29. TRPC1 protein forms only one type of native store-operated channels in HEK293 cells. PMID: 23079337
  30. findings reveal that Orai1 and TRPC1 mediate distinct local and global Ca(2+) signals following agonist stimulation of cells PMID: 23115638
  31. It plays a significance role in pathophysiological activation of astrocytes.(review) PMID: 22687694
  32. a functional interaction of TRPC1 with TRPV6 that negatively regulates Ca(2+) influx in HEK293 cells. PMID: 22932896
  33. TRPC1 is upregulated in G1 phase as compared with S phase, concomitant with an increased rate of regulatory cell volume decrease. PMID: 22744003
  34. Adipocyte TRPC1 and TRPC5 channel subunits contribute a constitutively active heteromultimeric channel that negatively regulates adiponectin, and through which the omega-3 fatty acids enhance adiponectin's anti-inflammatory activities. PMID: 22668831
  35. Data suggest that up-regulation of TRPC1 and consequent enhancement of calcium influx are crucial steps in decidualization of endometrial stromal cells probably via p-CREB-dependent transcriptional activity associated with FOXO1 activation. PMID: 22474110
  36. TRPC1 can modulate the metastasis of nasopharyngeal carcinoma (NPC). PMID: 22367186
  37. EGF, induced Ca(2+) release from the endoplasmic reticulum and Ca(2+) entry through TRPC1. Ca(2+) entry through TRPC1 conversely activated EGFR, suggesting that TRPC1 is a component of a Ca(2+)-dependent amplification of EGF-dependent cell proliferation. PMID: 22451676
  38. In a human neuroblastoma cell line, endogenous store-operated Ca2+ entry is dependent on TRPC1 activity. Neurotoxin treatment decreased TRPC1 expression, TRPC1 interaction with the SOCE modulator STIM1, and Ca2+ entry into the cells. PMID: 22446186
  39. a novel regulatory mechanism relying on the expression of TRPC1 and the subsequent formation of heteromeric TRPC channel complexes with reduced calcium permeability, thereby fine-tuning neuronal migration. PMID: 22157757
  40. critical aspects of the TRPC1 channelosome that are involved in the regulation of TRPC1 function and TRPC1-SOC-generated Ca2+ signals. PMID: 21747233
  41. Extensive TRPC1 transcript alternative splicing was observed, with exons 2, 3 and 5-9 frequently omitted, leading to variants containing premature termination codons. PMID: 21749700
  42. The cytoskeleton plays an essential role in regulation of store-operated calcium entry in the plasma membrane via modulation of the interaction between TRPC1 or calcium release-activated calcium modulator 1 (Orai1) and STIM1. PMID: 21640715
  43. TRPC1 expression is regulated by Orai1 to modulate and maintain Ca(2)+ signals. PMID: 21408196
  44. Data indicate that TRPC1 channel association with lipid rafts is essential for glioma chemotaxis in response to stimuli, such as EGF. PMID: 21506118
  45. results suggest that TRPC1 channels play an important role in glioma cell division most likely by regulating calcium signaling during cytokinesis PMID: 20544850
  46. Studies indicate that TRPC1, TRPC3, TRPC4, TRPC5 and TRPC6 channels are expressed in vascular smooth muscle cells from vessels of all calibers and in smooth muscle from organs such as the uterus and the gastrointestinal tract. PMID: 20515740
  47. results show that TRPC1 channels play a role in Ca(2+) influx and Ca(2+) homeostasis deregulation that mediate apoptosis induced by oxLDL PMID: 20187291
  48. TRPC1 is the generally expressed genes in normal and adenomatous human parathyroids. PMID: 20194530
  49. This study shows that TRPC1 interacts physically with TRPV4 to form a complex, and this TRPV4-TRPC1 complex may mediate flow-induced Ca(2+) influx in vascular endothelial cells. PMID: 20093626
  50. TrpC1 and TrpC4 Regulate Neurite Extension in human embryonic stem cell-Derived Neurons PMID: 19725137

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Transient receptor (TC 1.A.4) family, STrpC subfamily, TRPC1 sub-subfamily
Tissue Specificity
Seems to be ubiquitous.
Database Links

HGNC: 12333

OMIM: 602343

KEGG: hsa:7220

STRING: 9606.ENSP00000273482

UniGene: Hs.250687

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1