Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
FDG; HMUDG; MGC104370; Single strand selective monofunctional uracil DNA glycosylase 1; Single strand selective monofunctional uracil DNA glycosylase; Single-strand selective monofunctional uracil DNA glycosylase; SMUG 1; Smug1; SMUG1 protein; SMUG1_HUMAN; UNG 3; UNG3
Species
Homo sapiens (Human)
Expression Region
1-177aa
Target Protein Sequence
MPQAFLLGSIHEPAGALMEPQPCPGSLAESFLEEELRLNAELSQLQFSEPVGIIYNPVEYAWEPHRNYVTRYCQGPKEVLFLGMNPGPFGMAQTGVPFGEVSMVRDWLGIVGPVLTPPQEHPKRPVLGLECPQSEGPRQSMGHEIKSELLMGGCSWIRGKIQCDRVQVRRPGFSSQL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 1-177 constitute the expression domain of recombinant Human SMUG1. This SMUG1 protein is expected to have a theoretical molecular weight of 35.6 kDa. Expression of this SMUG1 protein is conducted in e.coli. Fusion of the N-terminal 6xHis-SUMO tag into the SMUG1 encoding gene fragment was conducted, allowing for easier detection and purification of the SMUG1 protein in subsequent stages.
Human single-strand selective monofunctional uracil DNA glycosylase (SMUG1) is a DNA repair enzyme crucial for base excision repair. SMUG1 specifically recognizes and removes uracil from single-stranded DNA, preventing mutagenesis. In genomics, SMUG1 is essential for maintaining genome integrity and stability. Research on SMUG1 extends to immunology, where it influences somatic hypermutation during antibody maturation. Additionally, SMUG1 is implicated in neurobiology, playing a role in oxidative DNA damage repair in neurons. Investigating SMUG1 provides insights into DNA repair mechanisms, genomic stability, and disease susceptibility, offering potential applications in understanding and preventing mutagenic events, as well as implications for immunology and neurological disorders.
