Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

SPRR2B

Uniprot No.

P35325

Research Area

others

Alternative Names

SPRR2B; Small proline-rich protein 2B; SPR-2B

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-72aa

Target Protein Sequence

MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

12.0kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Human SPRR2B was expressed with the amino acid range of 1-72. This SPRR2B protein is expected to have a theoretical molecular weight of 12 kDa. This protein is generated in a yeast-based system. The SPRR2B gene fragment has been modified by fusing the N-terminal 10xHis tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant SPRR2B protein during the following stages.

The human small proline-rich protein 2B (SPRR2B) is characterized by its high proline content and is involved in various cellular processes, particularly in the context of epithelial development and barrier function. SPRR2B is expressed in epithelial tissues, contributing to the structural integrity of the epithelium. It is found in the skin, esophagus, and other stratified squamous epithelia. It also participates in the process of cornification, a terminal differentiation process in epithelial cells where cells undergo structural changes to form the outermost layers of the epidermis. SPRR2B is implicated in the maintenance of the epidermal barrier, protecting the underlying tissues from external environmental factors. Aberrant expression of SPRR2B has been observed in certain skin disorders, suggesting its potential role in dermatological conditions. Research on SPRR2B focuses on understanding its precise functions in epithelial biology, including its role in tissue development, barrier formation, and its implications for skin health and disease.

Target Background

Function

Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.

Gene References into Functions

Knockdown of the Sprr2b gene or inhibition of SPRR2B phosphorylation attenuates USP7/MDM2 binding and p53 degradation, leading to fibroblasts cell cycle arrest. PMID: 29581288
An SNP in SPRR2B was predictive of asthma among white children with eczema from 2 independent populations. PMID: 22374195
We showed that just four genes, G3BP2, SCARB2, CSNK1A1 and SPRR2B, can classify patients as presence of lymph node metastasis negative or positive, with 80.0% accuracy. PMID: 21985131
SPR2B transcripts and protein were moderately increased in the human papillomaviurs 11- and 59-infected tissues. PMID: 14748073

Subcellular Location

Cytoplasm.

Protein Families

Cornifin (SPRR) family

Tissue Specificity

Suprabasal layers of squamous-differentiated tissues such as epidermis, esophagus, tongue and trachea.

Database Links

HGNC: 11262

OMIM: 182268

KEGG: hsa:6701

STRING: 9606.ENSP00000340703

UniGene: Hs.568239

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-YP022613HUb1
MSDS	MSDS
Size	$368
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Small proline-rich protein 2B (SPRR2B)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage