Recombinant Human Small ubiquitin-related modifier 4 (SUMO4)

Code CSB-EP718803HU
Abbreviation Recombinant Human SUMO4 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
SUMO4
Uniprot No.
Research Area
Cell Biology
Alternative Names
dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-95aa
Target Protein Sequence
MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.7kDa
Protein Length
Full Length of BC130305
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
Gene References into Functions
  1. meta-analysis demonstrated that the G allele of the SUMO4 M55V polymorphism could be a susceptible risk locus to type 2 diabetes mellitus, mainly in the Chinese population, while the association in other ethnic population needs to be further validated PMID: 28494838
  2. Both donor and recipient SUMO4 rs237025 polymorphisms contribute to the development of new-onset diabetes mellitus after liver transplantation. PMID: 28689037
  3. Results show that SUMO-4 is expressed in normal placental development. SUMO-4 expression was increased in pre-eclamptic placentas and in models of oxidative stress and hypoxic injury suggesting that SUMO-4 hyper-SUMOylation may be a potential post-translational mechanism in the stressed pre-eclamptic placenta. PMID: 28545138
  4. study suggests that SUMO4 c.163 G to A polymorphism is associated with the susceptibility to diabetic nephropathy in north Indian subjects with type 2 diabetes PMID: 27055882
  5. SUMO4 M55V polymorphism and type-2 diabetes were significantly associated with a possible SUMO4 region to type-2 diabetes susceptibility. PMID: 25189908
  6. No association between SUMO4 gene polymorphisms and acoronary artery disease with and without type 2 diabetes mellitus. PMID: 23042402
  7. SUMO4 Met55Val variant was associated with increased insulin resistance in Chinese patients with newly diagnosed type 2 diabetes. PMID: 21671169
  8. study demonstrates significant associations of SUMO4 M55V polymorphism with type 1 diabetes mellitus in Asian and Caucasian population and with type 2 diabetes mellitus in Asian population PMID: 22936652
  9. The C438T polymorphism in the SUMO4 gene is associated with significantly increased risk of papulopustular skin lesions in HLA-B51-positive Behcet's disease patients. PMID: 21901353
  10. This meta-analysis indicates that the SUMO4 M55V polymorphism confers susceptibility to type I diabetes in Asians and Europeans. PMID: 22884980
  11. the association between small ubiquitin-like modifier 4 (SUMO4) gene polymorphisms and type 2 diabetes mellitus PMID: 22425950
  12. Letter: report SUMO4 polymorphisms associated with protective effect in Tunisian rheumatoid arthritis patients. PMID: 21906435
  13. The SUMO4 gene single nucleotide polymorphism variant is not associated with susceptibility of the type 2 diabetes polymorphism. PMID: 20728233
  14. SUMO4 gene polymorphisms may be involved in the development of skin lesions, vascular Behcet's disease, as well as the severity of the disease. PMID: 20868570
  15. SUMO4 gene M55V variant is associated with the genetic susceptibility of type 1 diabetes mellitus (T1D) in Chinese children. PMID: 21158221
  16. This study suggests that in Taiwan the SUMO4 Met 55Val polymorphism is associated with susceptibility to T2DM and Type 2 diabetic patients with GG genotype have worse glycemic control. PMID: 19915388
  17. Observational study of gene-disease association. (HuGE Navigator) PMID: 20728233
  18. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20448286
  19. Meta-analysis of gene-disease association. (HuGE Navigator) PMID: 20518843
  20. total of 2317 families were genotyped for 15 SNPs in the SUMO4 region. PMID: 19956095
  21. we report evidence for an association between T1D and multiple single-nucleotide polymorphisms in 197 kb of genomic DNA in the IDDM5 interval. PMID: 15247916
  22. SUMO4 sumoylation may play an important role in the regulation of intracellular stress PMID: 16236267
  23. The M55V polymorphism was significantly associated with type 1 diabetes in Asian populations . PMID: 16306380
  24. results indicate that the small ubiquitin-like protein 4(SUMO4) is a more common autoimmune disease gene and a supplementary risk factor to type 1 diabetes PMID: 16735488
  25. SUMO4 SNP did not significantly influence predisposition to and features of rheumatoid artritis, in contrast to previous genetic and functional evidence that suggested its involvement. PMID: 16755651
  26. Genetic and functional evidence is provided supporting SUMO4 as a type 1 diabetes mellitus susceptibility gene. PMID: 17130563
  27. No significant association was found between SUMO4 M55V and LADA. PMID: 17130565
  28. SUMO4 gene methionine-valine variant is associated with severity of diabetic nephropathy in patients with type 2 diabetes. PMID: 17229939
  29. Our results show that Asian-Indians with T1DM are different from other Asian populations. Asian-Indians show more similarity to Caucasians with respect to the association of SUMO4 M55V variant in T1DM. PMID: 17373940
  30. contribution of the SUMO4 Met55Val polymorphism to both type 1 and type 2 diabetes susceptibility in the Japanese population PMID: 17374705
  31. SUMO4 protein appears to be either in extremely low abundance in human kidney or HEK293 cells or it is not present at all.It remains possible that SUMO4 protein is more abundant in other cell types or can be induced by hormonal or environmental challenges PMID: 17459725
  32. we conclude that SUMO4 M55V is associated with type I diabetes melitus in association with high-risk HLA-DR3 and DR4, but not by itself. PMID: 17554341
  33. study of the prevalence of four polymorphisms,CTLA-4 -318 C/T, 159 C/T, 3' STR and SUMO4 163 AG in latent autoimmune diabetes in adults; no association with either of the polymorphisms has been found PMID: 17558709
  34. reported a positive association of the SUMO4 M55V variant with diabetic nephropathy in an Asian cohort of 430 patients with type 2 diabetes PMID: 17660269
  35. data indicate that the M55V polymorphism in the small ubiquitin-like protein 4(SUMO4) gene is associated with a reduced risk of diabetic retinopathy in type 1 diabetes PMID: 17926234
  36. we will update the genetic evidence supporting SUMO4 as a T1D susceptibility gene and discuss the possible explanations for the discrepant associations observed in Caucasians vs Asians.[review] PMID: 17990297
  37. no associations of the SUMO4 rs237025 A>G polymorphism with the susceptibility of psoriasis were detected. PMID: 18330586
  38. SUMO4 +438 C allele is associated with susceptibility to Behcet's Disease (BD) in HLA-B51 negative Chinese Han patients, while the AGAT haplotype is protectively associated with BD in HLA-B51 negative patients PMID: 18657476
  39. These data not only confirmed previously published data, but also provided additional evidence suggesting a role for SUMO4 sumoylation in the regulation of intracellular stress. PMID: 18708028
  40. This study examines whether small ubiquitin-like modifier 4 (SUMO4) polymorphisms were associated with Vogt-Koyanagi-Harada (VKH) syndrome in the Chinese Han population. PMID: 19122825
  41. SUMO4 may act as a negative feedback regulator to prevent excessive activation of NFkappaB. PMID: 19222990
  42. Association of the polymorphism of SUMO4 with risk of coronary heart disease in type 2 diabetes is suggested. PMID: 19410319
  43. Observational study of gene-disease association. (HuGE Navigator) PMID: 19915388
  44. Observational study of gene-disease association. (HuGE Navigator) PMID: 19410319
  45. Observational study of gene-disease association. (HuGE Navigator) PMID: 19122825
  46. Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator) PMID: 18466472
  47. Observational study of gene-disease association. (HuGE Navigator) PMID: 18466531
  48. Observational study of gene-disease association. (HuGE Navigator) PMID: 18330586
  49. Observational study of gene-disease association. (HuGE Navigator) PMID: 12901503
  50. Observational study of gene-disease association. (HuGE Navigator) PMID: 15730420

Show More

Hide All

Protein Families
Ubiquitin family, SUMO subfamily
Tissue Specificity
Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
Database Links

HGNC: 21181

OMIM: 600320

KEGG: hsa:387082

STRING: 9606.ENSP00000318635

UniGene: Hs.657168

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*