Recombinant Human Solute carrier family 22 member 1 (SLC22A1), partial

Code CSB-EP021442HU1
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
SLC22A1
Uniprot No.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
43-149aa
Target Protein Sequence
GFTPDHHCQSPGVAELSQRCGWSPAEELNYTVPGLGPAGEAFLGQCRRYEVDWNQSALSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
24.5 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Translocates a broad array of organic cations with various structures and molecular weights including the model compounds 1-methyl-4-phenylpyridinium (MPP), tetraethylammonium (TEA), N-1-methylnicotinamide (NMN), 4-(4-(dimethylamino)styryl)-N-methylpyridinium (ASP), the endogenous compounds choline, guanidine, histamine, epinephrine, adrenaline, noradrenaline and dopamine, and the drugs quinine, and metformin. The transport of organic cations is inhibited by a broad array of compounds like tetramethylammonium (TMA), cocaine, lidocaine, NMDA receptor antagonists, atropine, prazosin, cimetidine, TEA and NMN, guanidine, cimetidine, choline, procainamide, quinine, tetrabutylammonium, and tetrapentylammonium. Translocates organic cations in an electrogenic and pH-independent manner. Translocates organic cations across the plasma membrane in both directions. Transports the polyamines spermine and spermidine. Transports pramipexole across the basolateral membrane of the proximal tubular epithelial cells. The choline transport is activated by MMTS. Regulated by various intracellular signaling pathways including inhibition by protein kinase A activation, and endogenously activation by the calmodulin complex, the calmodulin-dependent kinase II and LCK tyrosine kinase.
Gene References into Functions
  1. Two SNPs and two insertions/deletions were detected in exon 7 of SLC22A1. For exon 7, 1222AA carriers together with the presence of both the 8-bp insertion and 3-bp deletion, and M420del alleles showed higher possibility of developing resistance towards Imatinib mesylate (IM)treatment. Our results warrant the need of genotyping this SNP in terms of modulating IM treatment in chronic myeloid leukaemia patients. PMID: 30262695
  2. data indicate that OCT1 may contribute to uptake metformin and regulate pancreatic stellate cells (PSCs) activity. OCT1 is a target of metformin in regulating PSCs activity. PMID: 29949790
  3. inhibitory potency for morphine uptake was affected by the OCT1*2 allele. OCT2 showed only a limited uptake of ranitidine that was not significantly affected by the Ala270Ser polymorphism PMID: 29236753
  4. Results indicated that OCT1 rs628031 and ABCG2 rs2231142 were associated with plasma lamotrigine concentrations in Han Chinese patients with epilepsy. PMID: 27610747
  5. The additional role of SLC22A1/OCT1 genetics in M1 exposure in neonates. PMID: 27082504
  6. The pregnane X receptor down-regulates organic cation transporter 1 (SLC22A1) in human hepatocytes by competing for ("squelching") SRC-1 coactivator. PMID: 26920453
  7. Variants of SLC22A1 gene are associated with serum acylcarnitines and metabolic diseases. PMID: 28942964
  8. summarize current understanding of human OCT1 transporter hepatic gene regulation and propose potential post-transcriptional regulation by predicted miRNAs. PMID: 27278216
  9. The response to 6 months of metformin treatment (HbA1c , homeostasis model assessment for insulin resistance, fasting insulin, and glucose changes) did not differ between SLC22A1 wild-type subjects and carriers of presumably low-activity SLC22A1 alleles PMID: 27407018
  10. we assessed the role of miR-21 in mediating renal cell carcinoma chemoresistance and further showed that miR-21 silencing significantly (1) increased chemosensitivity of paclitaxel, 5-fluorouracil, oxaliplatin, and dovitinib; (2) decreased expression of multi-drug resistance genes; and (4) increased SLC22A1/OCT1, SLC22A2/OCT2, and SLC31A1/CTR1 platinum influx transporter expression PMID: 28714373
  11. This condensed chromatin structure is associated with binding of DNMT3B and decreased occupancy of OCT1 transcription factor at MAML2 enhancer, suggesting a role of DNMT3B in increasing methylation of MAML2 after stilbenoid treatment. PMID: 27207652
  12. genetic association studies in population of patients newly diagnosed type 2 diabetes in Bosnia and Herzegovina: Data suggest that genetic variations in OCT1 [R61C (rs12208357); M420del (rs72552763)] are associated with severe intolerance/gastrointestinal side effects due to metformin use in patients with type 2 diabetes. PMID: 26605869
  13. This study indicates a promising role for intratumoral OCT1 mRNA expression as a prognostic biomarker in therapeutic algorithms in HCC PMID: 26872727
  14. Homozygous carriers of the polymorphic OCT1 C-allele had no metformin-related toxicity as compared with 41.9% for any metformin-related toxicity in carriers of at least one wild-type A-allele PMID: 25753371
  15. hOCT1 is a suitable bendamustine transporter, thereby contributing to its cytotoxic effect depending upon the hOCT1 genetic variants expressed PMID: 25582574
  16. A positive association was observed between the expression of the ABCB1 and ABCG2 transporter genes (r=0.407, P<0.05) while no association was observed between the expression of either of the ABC transporter genes with the OCT1 gene PMID: 26354214
  17. Data indicate no association was found between genotypes of drug transporters ABCB1, ABCG2, OCT1 genetic polymorphisms and the occurrence of thrombocytopenia. PMID: 26546461
  18. Findings suggest specific involvement of each organic cation transporters (OCT1-3) in drug transportation. PMID: 25883089
  19. Data show that organic cation transporter (hOCT1) exon 2 GG homozygotes had higher imatinib (IM) levels than CG/CC genotypes, but the difference was not statistically significant. PMID: 24524306
  20. Our data suggest that besides bodyweight, OCT1 and ABCC3 genotypes play a significant role in the pharmacokinetics of intravenous morphine and its metabolites in children PMID: 25155932
  21. Nucleoside transporters and human OCT1 determine the cellular handling of DNA-methyltransferase inhibitors PMID: 24780098
  22. The hOCT1 expression level can be an important predictor in CML patients treated with IM. PMID: 25358338
  23. OCT1 plays a significant role in hepatic elimination of serotonin at the transporter level. PMID: 24688079
  24. Clopidogrel/clopidogrel carboxylate are strong inhibitors and high affinity substrates of OCT1. PMID: 24530383
  25. OCT1 genetic variants are associated with long term outcomes in imatinib treated chronic myeloid leukemia patients. PMID: 24215657
  26. The present study is the first report on the association of OCT-1 genetic polymorphisms with the overall development and jaundice-type progression of primary biliary cirrhosis. PMID: 23612856
  27. Cellular uptake of imatinib is independent of OCT1, and therefore OCT1 is apparently not a valid biomarker for imatinib resistance. PMID: 24352644
  28. OCT variants ( OCT1, OCT2 and ATM) were significantly associated with elevated baseline and glucose-induced C-peptide levels in polycystic ovary syndrome PMID: 24533710
  29. Rhodamine 123 is a high-affinity substrate for both hOCT1 and hOCT2. PMID: 22913740
  30. Decreased SLC22A1 mRNA expression is associated with low imatinib response in chronic myeloid leukemia. PMID: 24469953
  31. Glucocorticoid receptor-induced expression of HNF4alpha may contribute to indirect OCT1 gene up-regulation by dexamethasone in primary human hepatocytes. PMID: 24399729
  32. OCT1 genotypes play a significant role in intravenous morphine pharmacokinetics PMID: 23859569
  33. Hepatocellular carcinoma and cholangiocarcinoma is accompanied by OCT1(SCC22A1) down-regulation together with the appearance of genetic variants that may affect the ability of these tumors to take up and respond to sorafenib (chemoresistance). PMID: 23532667
  34. The SNP 408V>M (g.1222G>A) was present in 65% of CML patients & was associated in all cases with an 8-base-pair insertion (8(+) allele) at the 3' end of exon 7. Patients lacking 8(+) and 3(-) showed the best outcomes. PMID: 24117365
  35. The expression of Oct1 mRNA is mediated by loss of T cells, but not B cells in immune-mediated liver disease. PMID: 23929842
  36. The intron 1 evolutionary conserved region of OCT1 increases Oct1 promoter activity. PMID: 23922447
  37. The accumulation of lamivudine in CD4 cells of HIV-infected patients is related to the expression of OCT1 and OCT2. PMID: 22875535
  38. hOCT1 in the sinusoidal membrane of hepatocytes, and potentially the basolateral membrane of proximal tubule cells, is likely to play a role in the disposition of fluoroquinolone antimicrobial agents. PMID: 23545524
  39. demonstrated that PER2 served as a transcriptional corepressor, which recruited polycomb proteins EZH2 and SUZ12 as well as HDAC2 to octamer transcription factor 1 (OCT1) (POU2F1) binding sites of the TWIST1 and SLUG promoters PMID: 23836662
  40. The downregulation of OCT1 is associated with tumor progression and worse overall patient survival rates. PMID: 23440379
  41. Expression levels of OCT1 were not changed in relation to the -1756 genotypes. PMID: 22498645
  42. SLC22A1-ABCB1 haplotypes may influence IM pharmacokinetics in Asian CML patients. PMID: 23272163
  43. This mini-review discusses structural requirements for both OCT1 and OCT2 versus the blood-brain barrier choline transporter (BBBCHT) are discussed and compared. PMID: 22483271
  44. the data indicate that Oct1 regulates normal and cancer stem cell function PMID: 23144633
  45. Seven polymorphisms in OCT1, OCT2, and MATE1 genes were compared between 53 type 2 diabetes patients with side effects of metformin and 193 metformin users without symptoms of metformin intolerance. PMID: 22735389
  46. The hOCT1 SNPs M420del and M408V alter imatinib uptake and M420del modifies clinical outcome in imatinib-treated chronic myeloid leukemia. PMID: 23223357
  47. High-dose imatinib leads to superior molecular responses in patients with low OCT-1 activity. PMID: 22207690
  48. A substrate binding hinge domain is critical for transport-related structural changes of organic cation transporter 1. PMID: 22810231
  49. data suggest a model for the sequence of binding events involved in synergistic gene regulation by Sox2 and Oct1 PMID: 22718759
  50. evaluated the pretherapeutic mRNA expression of the hOCT1 (human organic cation transporter 1) gene in patients with chronic-phase (CP) chronic myeloid leukemia (CML) who varied in terms of their response to imatinib PMID: 22508387

Show More

Hide All

Subcellular Location
Basolateral cell membrane; Multi-pass membrane protein.
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Tissue Specificity
Widely expressed with high level in liver. Isoform 1 and isoform 2 are expressed in liver. Isoform 1, isoform 2, isoform 3 and isoform 4 are expressed in glial cell lines.
Database Links

HGNC: 10963

OMIM: 602607

KEGG: hsa:6580

STRING: 9606.ENSP00000355930

UniGene: Hs.117367

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*