Recombinant Human Solute carrier family 22 member 4 (SLC22A4), partial

In Stock
Code CSB-EP861980HU
Abbreviation Recombinant Human SLC22A4 protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SLC22A4
Uniprot No.
Research Area
Metabolism
Alternative Names
Ergothioneine transporter;ET transporter;Organic cation/carnitine transporter 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
42-141aa
Target Protein Sequence
LAGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. A key substrate of this transporter seems to be ergothioneine (ET).
Gene References into Functions
  1. The expression of SLC22A4, IL1R2 and VNN3, were independently associated with elevated neutrophil-to-lymphocyte ratio in chronic heart failure patients. PMID: 29901123
  2. Functional expression of Octn1 was demonstrated in activated hepatic stellate cell lines. PMID: 27020986
  3. Studies confirmed OCTN1-mediated transport of cytarabine and various structurally related cytidine analogues, such as 2'deoxycytidine and gemcitabine, occurs through a saturable process that is highly sensitive to inhibition by the classic nucleoside transporter inhibitors. PMID: 28209616
  4. These data reveal a role of OCTN1 in transporting acetylcholine and choline in HeLa cells. PMID: 25937167
  5. mutation in SLC22A4 encoding an organic cation transporter expressed in the cochlea strial endothelium causes human recessive non-syndromic hearing loss. PMID: 27023905
  6. Functional activity of L-carnitine transporters in human airway epithelial cells. PMID: 26607009
  7. SLC22A4 was associated with joint erosion in not-very-longstanding RA, although RA susceptibility association was weak and its clinical significance was uncertain. PMID: 25707686
  8. Functional expression of OCTN1 was confirmed in LPS-stimulated human macrophage-like cell line, THP-1. PMID: 26003890
  9. This meta-analysis demonstrates that the SLC22A4 F1 polymorphism is associated with susceptibility to RA in East Asians, but not in Europeans. PMID: 24972750
  10. Report functional/molecular effects of mercury compounds on the human OCTN1 cation transporter: C50 and C136 are the targets for potent inhibition. PMID: 25490951
  11. A lack of association between the SLC22A4 gene polymorphism rs3792876 and susceptibility to autoimmune thyroid diseases in a Chinese Han population. PMID: 26329403
  12. SLC22A4 gene polymorphisms played important roles in the etiology of rheumatoid arthritis in the Chinese population. PMID: 24599653
  13. Single nucleotide polymorphisms in SLC22A4 gene is associated with inborn errors of metabolism. PMID: 24850141
  14. The selenoneine-mediated OCTN1 system regulates secretory lysosomal vesicle formation and MeHg demethylation. PMID: 23709046
  15. Polymorphisms in OCTN1 and OCTN2 transporters genes are associated with prolonged time to progression in unresectable gastrointestinal stromal tumours treated with imatinib therapy PMID: 23127916
  16. Acetylcholine transport catalyzed by OCTN1 revealed an asymmetric regulation by Na(+). PMID: 22569296
  17. Only cells with strong expression of ETT can accumulate ET. In the human body, absorbtion, distribution and retain ET depends on this transporter. Blockade or inactivation of ETT in animal models may be essential to understand the function of ET [review] PMID: 22182480
  18. Data indicate that the 503F variant has increased in frequency due to recent positive selection and that disease-causing variants in linkage disequilibrium with 503F have hitchhiked to relatively high frequency, thus forming the IBD5 risk haplotype. PMID: 21816865
  19. OCTN1 could have a role in modulating the severity of chronic inflammation associated with sporadic colorectal cancer in early age and in ulcerative colitis patients. PMID: 21793125
  20. There was a trend towards higher carnitine transport in subjects with OCTN1 and OCTN2 mutations. PMID: 22325173
  21. a new transport role for OCTN1 and raise the possibility that its involvement in the non-neuronal acetylcholine system may be relevant to the pathogenesis of Crohn's disease PMID: 22206629
  22. This meta-analysis suggests that OCTN1/2 polymorphisms were associated with susceptibility of Crohn's disease in the Caucasian population but not in the East Asian population. PMID: 21706137
  23. Carnitine organic cation transporters 1 downregulation is associated with ulcerative colitis. PMID: 21910182
  24. SNPs and haplotype in the IBD5 SLC22A4/SLC22A5 region contribute to the development of particularly refractory Crohn's disease in the Slovenian population PMID: 21695374
  25. variants in SLC22A4 and SLC22A5 was dependent on rs6596075 risk haplotype in Crohn's disease. PMID: 21674708
  26. OCTN1-mediated transport of oxaliplatin contributes to its neuronal accumulation and treatment-limiting neurotoxicity in neurons. PMID: 21606177
  27. Results replicated the association of the OCTN1 rs1050152 (L503F) variant with Crohn's disease and inflammatory bowel disease. A weak gender-specific effect of rs1050152 (L503F) on male Ulcerative Colitis and female Crohn's Disease was observed. PMID: 21122496
  28. Variants carried by the haplotypes of SLC22A4, SLC22A5 and KIF3A region potentially contribute to tuberculosis susceptibility among the Thai population. PMID: 20485362
  29. These results indicate that OCTN1 plays a pivotal role for maintenance of systemic and intestinal exposure of ergothioneine providing a possible diagnostic tool to distinguish the inflammatory bowel diseases PMID: 20224991
  30. There was no evidence for epistasis between the IL23R gene and the Crohn's disease susceptibility genes CARD15 and SLC22A4/5. PMID: 17786191
  31. ipratropium and tiotropium are taken up primarily by OCTN2, and to a lesser extent by OCTN1, in bronchial epithelial cells PMID: 20020740
  32. Substrate discrimination by ergothioneine transporter SLC22A4 and carnitine transporter SLC22A5: gain-of-function by interchange of selected amino acids. PMID: 19814996
  33. Twenty four genetic variants of SLC22A4, including 14 were found to be novel, 16 in the coding exons (10 nonsynonymous and 6 synonymous variations) and 8 in the introns. PMID: 19881261
  34. An intronic SNP in a RUNX1 binding site of SLC22A4, encoding an organic cation transporter, is associated with rheumatoid arthritis PMID: 14608356
  35. Missense substitution in SLC22A4 is associated with Crohn disease PMID: 15107849
  36. Review. SLC22A4 is a susceptibility gene for rheumatoid arthritis. A functional SNP has an allele-specific effect on expression through variable binding of RUNX1. PMID: 15184985
  37. We conclude that the single nucleotide polymorphism that causes the amino acid mutation G462E abrogates transport activity, presumably affecting the physiological function of OCTN1 and/or the pharmacological characteristics of its substrates. PMID: 15459889
  38. 2 functionally relevant polymorphisms in the SLC22A4 / 22A5 genes at the IBD5 locus that alter gene/protein function and are associated with increased risk for Crohn's disease. PMID: 15685536
  39. key substrate of this transporter is ergothioneine PMID: 15795384
  40. OCTN1 is involved in renal excretion of organic cations across the apical membrane. PMID: 15832501
  41. antibody raised to an epitope during C. jejuni or M. paratuberculosis enterocolitis may crossreact with an intestinal epithelial cell functional variant of OCTN1, an already less efficient carnitine transporter, initiating inflammatory bowel disease PMID: 16246312
  42. The 1672C>T SLC22A4 and -207G>C SLC22A5 polymorphisms are genetic markers of susceptibility/protection haplotypes for Crohn's disease. PMID: 16333318
  43. the 1672T variant of the OCTN1 gene and the -207C variant of the OCTN2 gene represent risk factors for Crohn disease in the Greek population PMID: 16437728
  44. the SLC22A4 and RUNX1 polymorphisms did not show a significant role in rheumatoid arthritis susceptibility in a Spanish PMID: 16652416
  45. Results showed endogenous expression of native OCTN1 in HepG2 cell mitochondria. PMID: 16729965
  46. A recent report identified polymorphisms in SLC22A4 (OCTN1) and SLC22A5 (OCTN2) as being responsible for the IBD5 association inflammatory bowel disease). PMID: 16773684
  47. One of the tested polymorphisms in the SLC22A4 gene at 1672 showed significant association with type 1 diabetes. PMID: 16796743
  48. The frequency of the NOD2/CARD15 susceptibility variants in the Hungarian pediatric CD population is high. SLC22A4 and SLC22A5 mutation screening do not confirm the assumption that the carriage of these genotypes means an obligatory susceptibility to CD. PMID: 17006998
  49. The IBD5 locus is associated with CD in the Swedish population. The strongest association is with the marker SNP IGR2096a_1, lying p-telomeric to SLC22A4 and SLC22A5. The effect of the TC haplotype was not an independent determinant in this population. PMID: 17340776
  50. The SLC22A4 1672T allele frequency was 46.7% in the patients with UC and 46.4% in the controls PMID: 17387389

Show More

Hide All

Involvement in disease
Rheumatoid arthritis (RA)
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Major facilitator (TC 2.A.1) superfamily, Organic cation transporter (TC 2.A.1.19) family
Tissue Specificity
Widely expressed. Highly expressed in whole blood, bone marrow, trachea and fetal liver. Weakly expressed in kidney, skeletal muscle, prostate, lung, pancreas, placenta, heart, uterus, spleen and spinal cord. Highly expressed in intestinal cell types affe
Database Links

HGNC: 10968

OMIM: 180300

KEGG: hsa:6583

STRING: 9606.ENSP00000200652

UniGene: Hs.310591

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*