Recombinant Human Solute carrier family 45 member 3 (SLC45A3),partial

In Stock
Code CSB-MP836239HU
Abbreviation Recombinant Human SLC45A3 protein, partial
MSDS
Size $114
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SLC45A3
Uniprot No.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
412-477aa
Target Protein Sequence
PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.3 kDa
Protein Length
Partial
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. Identification of a novel autoimmune peptide epitope of prostein in prostate cancer has been reported. PMID: 27700103
  2. CTCF has a role in regulating SLC45A3-ELK4 Chimeric RNA PMID: 26938874
  3. genome-wide association studies show that the top SNP associated with log PSA 9Prostate-specific antigen) levels was rs2153904 in SLC45A3. PMID: 25434496
  4. Genome-wide association study identified novel genetic variant on SLC45A3 gene associated with serum levels prostate-specific antigen (PSA) in a Chinese population. PMID: 23269536
  5. This study provides first evidence that the expression of SLC45A3 protein is down regulated through SLC45A3-ERG fusion in prostate cancer. PMID: 22821757
  6. Data suggest that chimeric SLC45A3-ELK4 controls prostate cancer cell proliferation, and the chimera level correlates with prostate cancer disease progression. PMID: 22719019
  7. Double sequential immunohistochemical staining with p63 and P501S is highly specific and can be a useful tool in distinguishing urothelial carcinoma from prostate carcinoma. PMID: 21777423
  8. This is the first study to report concurrent TMPRSS2 and SLC45A3 rearrangements in the same tumor focus in prostate cancer PMID: 20118910
  9. T cells that recognize naturally processed epitopes from prostein were expanded from healthy donors and characterized. T cells isolated from males were of low avidity and recognized subdominant epitopes while those from females were of higher avidity PMID: 15048720
  10. Prostein is expressed in the vast majority of prostatic tissues, regardless of grade and metastatic status. No expression was detected in 4,700 normal and malignant tissue samples representing the great majority of essential tissues and tumors. PMID: 15176054
  11. P501S is a sensitive and highly specific marker for identifying prostate tissue. Combined use of prostein/prostate specific antigen used to detect prostatic origin of metastatic carcinomas. PMID: 17721190
  12. A SLC45A3:ETV5 gene fusion was identified in prostate cancer. PMID: 18172298
  13. Intronic miRNAs from tissue-specific transcripts, or their natural absence, make cardinal contributions to cellular gene expression and phenotype. PMID: 18193184
  14. This study demonstrates that most ERG-overexpressing prostate cancers harbor hormonally regulated TMPRSS2-ERG, SLC45A3-ERG, or NDRG1-ERG fusions PMID: 19649210
  15. SLC45A3-ELK4 may represent the first description of a recurrent RNA chimaeric transcript specific to prostate cancer that does not have a detectable DNA aberration PMID: 19136943

Show More

Hide All

Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Glycoside-pentoside-hexuronide (GPH) cation symporter transporter (TC 2.A.2) family
Tissue Specificity
Prostate specific. Expressed in all prostatic glandular cells. Expressed both in normal and cancerous prostates.
Database Links

HGNC: 8642

OMIM: 605097

KEGG: hsa:85414

STRING: 9606.ENSP00000356113

UniGene: Hs.278695

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*