Recombinant Human Solute carrier organic anion transporter family member 1A2 (SLCO1A2),partial

Code CSB-YP021741HUa4
Abbreviation Recombinant Human SLCO1A2 protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SLCO1A2
Uniprot No.
Research Area
Others
Alternative Names
OATP-A;Organic anion-transporting polypeptide 1;Sodium-independent organic anion transporter;Solute carrier family 21 member 3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
406-513aa
Target Protein Sequence
FLMTCENSSVVGINTSYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMVFQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-sumostar-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Mediates the Na(+)-independent transport of organic anions such as sulfobromophthalein (BSP) and conjugated (taurocholate) and unconjugated (cholate) bile acids. Selectively inhibited by the grapefruit juice component naringin.
Gene References into Functions
  1. Our findings uncover novel associations of progressive supranuclear palsy with SLCO1A2 (rs11568563) and DUSP10 (rs6687758) variants PMID: 29986742
  2. The binding site may be responsible in part for the suppression effect of TNFalpha towars SLCO1A2 expression. PMID: 29549185
  3. SLCO1A2 and SLCO1B1 gene treatment over time interactions were associated with gametocytemia clearance rate. PMID: 28975866
  4. OATP1A2, OATP1B1, and OATP2B1 can mediate cellular uptake of ochratoxin A, which could aggravate OTA toxicity. PMID: 28532671
  5. important roles for OATP1A/1B in transporter-mediated uptake and disposition of doxorubicin, are reported. PMID: 27777271
  6. data provide the implication of UGT1A1 and SLCO1A2 in sickle cell anemia-related cholelithiasis. PMID: 26146896
  7. Genetic polymorphisms and function of the OATP1A2 and its clinical relevance in drug disposition PMID: 25924632
  8. Report OATP1A2 expression in human retinal pigmented epithelial cells and suggest role in cellular uptake of all-trans retinol. PMID: 25560245
  9. analysis of how the transmembrane domain 6 of the human organic anion transporting polypeptide 1A2 (OATP1A2) influences transporter substrate binding, protein trafficking, and quality control PMID: 25387129
  10. PDZK1 and NHERF1 regulate the transport function of OATP1A2 by modulating protein internalization via a clathrin-dependent pathway and by enhancing protein stability. PMID: 24728453
  11. Combined high OATP1A2/high OCT6 may be a potential predictor of response to anthracycline/taxane-based chemotherapy in breast cancer PMID: 24671357
  12. human OATP1B1, OATP1B3 and OATP1A2 can transport docetaxel in vivo. PMID: 24825069
  13. Five novel single nucleotide polymorphisms (SNIP)S in the coding exons of SLCO1A2 gene transporter have been identified. PMID: 23918469
  14. Human OATP1A/1B transporters play an important role in plasma and tissue distribution of the structurally diverse chemotherapeutics methotrexate and paclitaxel PMID: 23243220
  15. results suggest that enhanced OATP1A2 expression is associated with adaptive cell growth of prostate cancer cells under androgen-depleted conditions PMID: 22864060
  16. Hydrophilic anti-migraine triptans are substrates for OATP1A2, a transporter expressed at human blood-brain barrier. PMID: 22509823
  17. SLCO1A2 promoter variant 1 was strongly induced by vitamin D receptor. PMID: 22474172
  18. The expression of OATP1A2 and OATP1B3 in placenta decreased in, and may be involved in the pathophysiology of, intrahepatic cholestasis of pregnancy. OATP1A2 was localized to the vasculo-syncytial membrane and apical surface of syncytiotrophoblasts. PMID: 22203093
  19. Data suggest that inhibition of OATP1A2 in intestinal mucosa at least partially explains effects of grapefruit juice (or grapefruit juice components such as the flavonoid naringin) on pharmacokinetics of aliskiren, an antihypertensive agent. PMID: 22124880
  20. Digoxin inhibited the uptake of probe substrates of OATP1B1 (IC(50) of 47 muM), OATP1B3 (IC(50) > 8.1 muM), and OATP2B1 (IC(50) > 300 muM), but not OATP1A2 in transfected cell lines. PMID: 21849517
  21. protein kinase C(PKC) regulates the transport function of OATP1A2 by modulating protein internalization; this effect of PKC is mediated in part by clathrine-dependent pathways PMID: 21133891
  22. SLCO1A2 polymorphisms significantly affect imatinib pharmacokinetics. PMID: 21633340
  23. Although imatinib is indicated as a substrate for OATP1A2, this transporter by itself is unlikely to contribute substantially to the absorption profiles of imatinib in humans. PMID: 21508937
  24. data suggest that among the many known transporters common variations of PXR, SLCO1A2, SLCO1B1, SLCO1B3, and SLCO2B1 do not contribute to breast carcinogenesis PMID: 20635135
  25. Is present in high frequencies in the finnish population PMID: 20560925
  26. By using the presence of bilirubin as a phenotype, variants rs6742078 (UGT1A1; P = .003), rs4149056 (SLCO1B1; P = .003), and rs4149000 (SLCO1A2; P = .015) were associated with gallstone composition PMID: 20837016
  27. Antiretroviral protease inhibitors, but not non-nucleoside reverse transcriptase inhibitors, are substrates for OATP1A2, OATP1B1 and OATP1B3. PMID: 20051929
  28. SLCO1A2 polymorphisms may be an important yet unrecognized contributor to inter-individual variability in drug disposition and central nervous system entry of substrate drugs. PMID: 15632119
  29. a potentially important role for OATP-A in the absorption and disposition of saquinovir in vivo. PMID: 15832500
  30. Review summarizes current knowledge on the functional and phenotypic consequences of genetic variation in intestinally, hepatically and renally expressed members of the organic anion-transporting polypeptide (OATP) family. PMID: 18466105
  31. the interplay between a xenobiotic nuclear receptor PXR and OATP1A2 that could contribute to the pathogenesis of breast cancer. PMID: 19010908

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
Organo anion transporter (TC 2.A.60) family
Database Links

HGNC: 10956

OMIM: 602883

KEGG: hsa:6579

STRING: 9606.ENSP00000305974

UniGene: Hs.46440

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*