Recombinant Human Sorcin(SRI)

Code CSB-EP022665HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P30626
Relevance Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 22 kDa protein CP-22
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAYPGHPGAGGGYYPGGYGGAPGGPAFPGQTQDPLYGYFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLMVSMLDRDMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTMGFRLSPQAVNSIAKRYSTNGKITFDDYIACCVKLRALTDSFRRRDTAQQGVVNFPYDDFIQCVMSV
Research Area Signal Transduction
Source E.coli
Gene Names SRI
Protein Names Recommended name: Sorcin Alternative name(s): 22 kDa protein CP-22 Short name= CP22 V19
Expression Region 1-198aa
Tag Info N-terminal GST-tagged
Mol. Weight 48.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Calcium-binding protein that modulates excitation-contraction coupling in the heart. Contributes to calcium homeostasis in the heart sarcoplasmic reticulum. Modulates the activity of RYR2 calcium channels.
Subcellular Location Cytoplasm, Sarcoplasmic reticulum membrane, Peripheral membrane protein, Cytoplasmic side
Tissue Specificity Detected in cardiac myocytes.
Database Links

HGNC: 11292

OMIM: 182520

KEGG: hsa:6717

STRING: 9606.ENSP00000265729

UniGene: Hs.489040

Related Products

SRI Antibodies

SRI Antibodies for Homo sapiens (Human)

SRI Antibodies for Human

SRI Proteins

SRI Proteins for Homo sapiens (Human)

SRI ELISA Kit

SRI ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.