Recombinant Human Squamous cell carcinoma antigen recognized by T-cells 3 (SART3), partial

Code CSB-EP624010HU
Abbreviation Recombinant Human SART3 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP624010HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SART3.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP624010HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) SART3.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SART3
Uniprot No.
Research Area
Cancer
Alternative Names
DSAP1; hSART 3; hSART-3; P100; P110; p110(nrb); RP11 13G14; SART 3; SART-3; SART3; SART3_HUMAN; Squamous cell carcinoma antigen recognized by T cells 3; Squamous cell carcinoma antigen recognized by T-cells 3; Tat interacting protein of 110 kDa; Tat-interacting protein of 110 kDa; Tip110
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
600-900aa
Target Protein Sequence
QRKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNVEVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDTKLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPCVDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.8kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
U6 snRNP-binding protein that functions as a recycling factor of the splicing machinery. Promotes the initial reassembly of U4 and U6 snRNPs following their ejection from the spliceosome during its maturation. Also binds U6atac snRNPs and may function as a recycling factor for U4atac/U6atac spliceosomal snRNP, an initial step in the assembly of U12-type spliceosomal complex. The U12-type spliceosomal complex plays a role in the splicing of introns with non-canonical splice sites. May also function as a substrate-targeting factor for deubiquitinases like USP4 and USP15. Recruits USP4 to ubiquitinated PRPF3 within the U4/U5/U6 tri-snRNP complex, promoting PRPF3 deubiquitination and thereby regulating the spliceosome U4/U5/U6 tri-snRNP spliceosomal complex disassembly. May also recruit the deubiquitinase USP15 to histone H2B and mediate histone deubiquitination, thereby regulating gene expression and/or DNA repair. May play a role in hematopoiesis probably through transcription regulation of specific genes including MYC.; Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication.
Gene References into Functions
  1. Data suggest that ZIP, USP39, Prp24/p100/SART3, and Prp43 associate to form complex instrumental in spliceosome assembly; ZIP regulates pre-mRNA splicing of USP39 independent of RNA binding; stable 35S tri-snRNP particles are enriched in Cajal body. (ZIP = zinc finger and G-patch domain-containing protein; USP39 = ubiquitin specific peptidase 39; Prp43 = RNA helicase Prp43) PMID: 28878014
  2. We show that PRP31, a component of U4 snRNP, is modified with K63-linked ubiquitin chains by the PRP19 complex and deubiquitinated by USP15 and its substrate targeting factor SART3. USP15SART3 makes a complex with USP4 and this ternary complex serves as a platform to deubiquitinate PRP31 and PRP3 PMID: 28088760
  3. The complex structure of SART3 nuclear localization signal (NLS) and importin-alpha reveals bipartite binding, and removal of SART3 NLS prevents the entry of USP4 (and USP15) into the nucleus and abrogates the subsequent deubiquitinase activity of USP4. PMID: 27060135
  4. crystal structures of SART3 in the apo-form and in complex with the DUSP-UBL domain of USP15 at 2.0 and 3.0 A, respectively. Structural analysis reveals SART3 contains 12 half-a-tetratricopeptide (HAT) repeats, organized into two subdomains, HAT-N and HAT-C. SART3 dimerizes through the concave surface of HAT-C, whereas the HAT-C convex surface binds USP15 in a novel bipartite mode. PMID: 27255711
  5. miR-124 regulates Tip110 expression and differentiation of human cord blood CD34(+) cells PMID: 25928721
  6. Hypoxia led to Tip110 protein degradation through the ubiquitin-proteasome system. Under hypoxia, Tip110 stabilized p53, which in return destabilized Tip110. PMID: 25939381
  7. SART3 recruits ubH2B, which may be evicted from DNA during transcription, for deubiquitination by Usp15 PMID: 24526689
  8. these findings have provided additional and mechanistic evidence to support Tip110 function in HIV-1 transcription. PMID: 24217245
  9. Results identify a novel frameshift mutation in this gene implicated in disseminated superficial actinic porokeratosis in 4 Chinese families PMID: 23834120
  10. YB-1 potentiates the Tip110/Tat-mediated transactivation of the HIV-1 LTR promoter. PMID: 23822148
  11. findings show C-MYC upregulates transcription of TIP110 through interaction with the TIP110 E-box in the TIP110 promoter, ensuring high-level Tip110 expression in proliferating embryonic stem cells (hESCs); further show TIP110 regulates OCT4 alternative splicing in hESCs PMID: 23088399
  12. TIP110 is also expressed in human embryonic stem cells (hESCs) and expression was decreased with differentiation of these ESCs. PMID: 22132941
  13. detectable in majority of colorectal carcinoma tissues studied; could be an appropriate molecule for use in specific immunotherapy for colorectal carcinoma PMID: 11920522
  14. Results suggest that U4 and U6 small nuclear ribonucleoproteins (snRNPs) accumulate in Cajal bodies for the purpose of assembly into U4/U6 snRNPs by SART3/p110. PMID: 12578909
  15. involvement of U6-p110 (SART3) in recycling of the U4atac/U6atac snRNP PMID: 14749385
  16. Tip110 is a negative regulator of AR transcriptional activation, and may be directly involved in AR-related developmental, physiological, and pathological processes PMID: 15031286
  17. Data suggest a model whereby p110 (SART3) brings together U4 and U6 snRNAs through both RNA-protein and protein-protein interactions. PMID: 15314151
  18. Both purified and recombinant LSm2-8 proteins are able to recruit p110 protein to U6 snRNA via interaction with the highly conserved C-terminal region of p110. PMID: 18567812
  19. Levels of anti-SART3 peptide antibody in prostate cancer patients are significantly higher than those of non-cancer subjects. PMID: 19148489

Show More

Hide All

Subcellular Location
Nucleus, nucleoplasm. Nucleus, Cajal body. Nucleus speckle. Cytoplasm.
Tissue Specificity
Ubiquitously expressed.
Database Links

HGNC: 16860

OMIM: 611684

KEGG: hsa:9733

STRING: 9606.ENSP00000228284

UniGene: Hs.584842

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*