Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Stanniocalcin 1; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMAN
Species
Homo sapiens (Human)
Expression Region
39-247aa
Target Protein Sequence
SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human STC1 contains amino acids 39-247. The expected molecular weight for the STC1 protein is calculated to be 50.6 kDa. This STC1 protein is produced using e.coli expression system. The STC1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant STC1 protein in following stages of expression and purification.
Human stanniocalcin-1 (STC1) is known to regulate cellular responses to stress, inflammation, and hypoxia. It has been implicated in angiogenesis, cell proliferation, and apoptosis, indicating its involvement in tissue development and repair. Moreover, STC1 has been associated with cancer, with varying roles in different types of tumors, either promoting or inhibiting tumor progression. In addition to its endocrine functions, STC1 acts as a paracrine or autocrine factor in various tissues. The diverse functions of STC1 make it an intriguing molecule with potential implications in both normal physiology and disease states, particularly in the context of cancer and tissue homeostasis.