Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

STC1

Uniprot No.

P52823

Research Area

Metabolism

Alternative Names

Stanniocalcin 1; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMAN

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

39-247aa

Target Protein Sequence

SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

50.6kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The region for expressing recombinant Human STC1 contains amino acids 39-247. The expected molecular weight for the STC1 protein is calculated to be 50.6 kDa. This STC1 protein is produced using e.coli expression system. The STC1 coding gene included the N-terminal GST tag, which simplifies the detection and purification processes of the recombinant STC1 protein in following stages of expression and purification.

Human stanniocalcin-1 (STC1) is known to regulate cellular responses to stress, inflammation, and hypoxia. It has been implicated in angiogenesis, cell proliferation, and apoptosis, indicating its involvement in tissue development and repair. Moreover, STC1 has been associated with cancer, with varying roles in different types of tumors, either promoting or inhibiting tumor progression. In addition to its endocrine functions, STC1 acts as a paracrine or autocrine factor in various tissues. The diverse functions of STC1 make it an intriguing molecule with potential implications in both normal physiology and disease states, particularly in the context of cancer and tissue homeostasis.

Target Background

Function

Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.

Gene References into Functions

these results suggest that mesenchymal stem cells protect vascular cells from inflammatory injury partially by secreting STC1 PMID: 29857240
Data indicate that stanniocalcin 1 (STC1) is a non-canonical NOTCH1 ligand and acts as a crucial regulator of stemness in glioblastoma (GBM). PMID: 29196129
these data demonstrated that STC1 can promote cell apoptosis via NF-kappaB phospho-P65 (Ser536) by PI3K/AKT, IkappaBalpha and IKK signaling in cervical cancer cells PMID: 28545028
Ssecretory STC1 enhances metastatic potential of hepatocellular carcinomas via JNK signaling. PMID: 28688970
Glycolysis from glucose is regulated by hSTC-1, decreasing the adequate supply of glycerol-3-phosphate (G3P) needed for fatty acid esterification and triacylglycerol (TG) storage in brown adipose tissue (BAT). The decrease of TG capacity synthesis from glucose by hSTC-1 compromises the BAT thermogenic capacity. PMID: 28435144
Increased STC1 plasma level represents a hallmark of late-onset preeclampsia; STC1 gene variants modulate placental gene expression and maternal hormone levels. PMID: 27603899
Latanoprost-induced reduction of intraocular pressure is mediated through the downstream signaling molecule STC-1. When used by itself, STC-1 exhibits ocular hypotensive properties. PMID: 28538979
Study demonstrates that STC1 is overexpressed in the prostate carcinoma cell lines and suggests that it promotes prostate carcinoma cell proliferation via cyclin E1/CDK2. PMID: 28350121
In the fed state, STC1 increases the incorporation of (14)C from glucose into lipids in the white retroperitoneal adipose tissue (WRAT). STC1 is one of the hormonal factors that control glucose metabolism in WRAT in the fed state. PMID: 27730346
STC1 protein is significantly up-regulated in midsecretory endometrial fluid and is dysregulated in eutopic endometrial tissue from women with endometriosis. It is likely regulated by cAMP and may be involved in the pathogenesis of decidualization defects. PMID: 27322879
STC1 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
elevated STC-1 expression is associated with poor clinical outcome in triple-negative breast cancer (TNBC) patients, and STC-1 is directly involved in the invasiveness of TNBC cells PMID: 27461417
we demonstrated that aberrant STC1 expression is associated with poor prognosis and stimulates the invasiveness of triplenegative breast cancer cells PMID: 27459971
our findings strongly suggest that elevated expression of STC1 protein at the III-IV stage of lung adenocarcinoma promotes tumorigenesis of lung adenocarcinoma and positively associates with the cancer progression, which may be of potential value as tumor marker in clinical tracking lung adenocarcinoma progression. PMID: 26577859
Data suggest that stanniocalcin 1 and 2 (STC1, STC2) participate in inhibition of proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) during folliculogenesis. PMID: 26874357
STC1 gene expression at diagnosis might be a useful prognostic marker for clinical outcome and monitoring therapeutic response in patients with acute leukemia. PMID: 26547904
STC1 blunts bleomycin-induced rise in thrombin protein and activity, diminishes thrombin-induced signaling through PAR1 to ERK, and inhibits bleomycin-induced pneumonitis. PMID: 26640170
Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1. PMID: 26531219
High expression levels of stanniocalcin-1 is associated with Hepatocellular Carcinoma. PMID: 26469082
Results show that STC1 have an important role in the carbohydrate metabolism regulation, in particular gluconeogenesis from glutamine in the kidney, across the vertebrates. PMID: 26187698
Stanniocalcin 1 is expressed in thyroid side population cells and thyroid cancer cells. PMID: 25647164
Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4). PMID: 26195635
These findings demonstrate a role for STC1 in metastasis of early stage clear cell renal cell carcinoma. PMID: 25740019
Mesenchymal stem cells correct inappropriate epithelial-mesenchyme relation in pulmonary fibrosis using Stc1. PMID: 25373521
These results suggested that STC1 may be a valuable biomarker in diagnosing malignant degree of glioma and evaluating prognostic following surgery PMID: 25783529
STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition. PMID: 25591908
Stanniocalcin 1 downregulation is responsible for sorafenib-induced cardiotoxicity through activated ROS generation. PMID: 25370841
Circulating STC1 and STC2 mRNA are potentially useful blood markers for LSCC PMID: 24743310
This is the first study to show definitively that STC1 plays an oncogenic role in breast cancer, and indicates that STC1 could be a potential therapeutic target for treatment of breast cancer patients. PMID: 25391215
High STC1 expression is associated with glioma. PMID: 24729417
was indicated that secreted STC-1 promotes metastatic potential of breast cancer cells via activation of PI3K/AKT PMID: 25056605
Stanniocalcin-1 and -2 promote angiogenic sprouting in HUVECs via VEGF/VEGFR2 and angiopoietin signaling pathways. PMID: 23664860
An anti-apoptotic protein stanniocalcin-1 (STC-1) can prevent loss of retinal ganglion cells in the rat retina with optic nerve transection PMID: 23667669
Data of this experiment showed that higher STC-1 expression during 96 h of preconditioning correlated with more effective MMP protection through the regulation of intracellular level of ROS and cytosolic free Ca2 + and preservation of cell viability. PMID: 23566487
STC1 is differentially expressed in the culprit coronary plaques of patients with acute myocardial infarction versus those with stable angina. STC1 may play a role in plaque instability. PMID: 23757035
Thus, these results provided evidence that STC1 inhibited cell proliferation and invasion through NF-kappaB p65 activation in cervical cancer. PMID: 23382863
Data indicate that the secreted glycoprotein stanniocalcin-1 (STC1) as a mediator of metastasis by PDGF receptor function in the setting of colorectal cancer. PMID: 23243022
STC-1 mRNA expression is a reliable marker for detection of DTCs in PB and BM of ESCC patients, and STC-1-positive DTCs may be a promising tool for diagnosis and prognosis assessment in ESCC. PMID: 22537917
STC1 is a potentially useful blood marker for predicting biological tumor aggressiveness in patients with gastric cancer PMID: 22889960
STC1 activates a novel anti-oxidant pathway in cardiac myocytes through induction of UCP3 PMID: 22693564
Stanniocalcin (STC1) plays an important role in functional adaption in pediatric kidney transplantation. PMID: 22588538
Overexpression of STC1 was an independent prognostic factor in patients with esophageal cancer who had undergone curative surgery. PMID: 22200953
Level of circulating STC1 mRNA in NSCLC was significantly higher than in benign pulmonary disease or healthy volunteers. Higher levels of circulating STC1 mRNA were associated with more advanced tumor stages and histological subtypes. PMID: 21656524
The results demonstrate that PKCalpha suppresses the expression of STC1 in breast cancer cells. PMID: 21720730
STC-1 could promote angiogenesis in vitro and in vivo, and the angiogenesis was consistent with VEGF expression in vitro. Inhibition of VEGF expression in supernatants with neutralizing antibody markedly abolished angiogenesis induced by STC-1 in vitro. PMID: 21672207
Vascular endothelial growth factor-D stimulates endothelial cell VEGF-A, stanniocalcin-1, and neuropilin-2 and has potent angiogenic effects. PMID: 21474827
STC1 plays an important role in the early response to mechanical injury by epithelial cells by modulating signaling of extracellular ATP PMID: 20422040
STC1 induction by thyroid hormone depends on both TRbeta and PI3K activation. PMID: 20827662
High STC1 gene expression is associated with colorectal cancer. PMID: 21273618
Human stanniocalcin-1 or -2 expressed in mice reduces bone size and severely inhibits cranial intramembranous bone growth. PMID: 20174869

Hide All

Subcellular Location

Secreted.

Protein Families

Stanniocalcin family

Tissue Specificity

Expressed in most tissues, with the highest levels in ovary, prostate, heart, kidney and thyroid. In the kidney, expression is confined to the nephron, specifically in the distal convoluted tubule and in the collecting tubule. Not detected in the brain, l

Database Links

HGNC: 11373

OMIM: 601185

KEGG: hsa:6781

STRING: 9606.ENSP00000290271

UniGene: Hs.25590

Code	CSB-EP022821HU1
Abbreviation	Recombinant Human STC1 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Stanniocalcin-1 (STC1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage