Recombinant Human Stanniocalcin-1(STC1),partial

In Stock
Code CSB-EP022821HU1a2
Product Type Recombinant Protein
Size US$1726Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P52823
Lead Time 3-7 business days
Relevance Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias STC
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Research Area Signal Transduction
Source E.coli
Gene Names STC1
Expression Region 39-247aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.6kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Subcellular Location Secreted
Protein Families Stanniocalcin family
Tissue Specificity Expressed in most tissues, with the highest levels in ovary, prostate, heart, kidney and thyroid. In the kidney, expression is confined to the nephron, specifically in the distal convoluted tubule and in the collecting tubule. Not detected in the brain, l
Database Links

HGNC: 11373

OMIM: 601185

KEGG: hsa:6781

STRING: 9606.ENSP00000290271

UniGene: Hs.25590

Related Products

STC1 Antibodies

STC1 Antibodies for Homo sapiens (Human)

STC1 Antibodies for Human

STC1 Proteins

STC1 Proteins for Homo sapiens (Human)

STC1 ELISA Kit

STC1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.