Recombinant Human Stanniocalcin-1 (STC1), partial

In Stock Promotion
Code CSB-EP022821HU1a2
Abbreviation Recombinant Human STC1 protein, partial
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Stanniocalcin 1; Stanniocalcin; Stanniocalcin-1; STC; STC-1; Stc1; STC1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
39-247aa
Target Protein Sequence
SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
39.6kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Stimulates renal phosphate reabsorption, and could therefore prevent hypercalcemia.
Gene References into Functions
  1. these results suggest that mesenchymal stem cells protect vascular cells from inflammatory injury partially by secreting STC1 PMID: 29857240
  2. Data indicate that stanniocalcin 1 (STC1) is a non-canonical NOTCH1 ligand and acts as a crucial regulator of stemness in glioblastoma (GBM). PMID: 29196129
  3. these data demonstrated that STC1 can promote cell apoptosis via NF-kappaB phospho-P65 (Ser536) by PI3K/AKT, IkappaBalpha and IKK signaling in cervical cancer cells PMID: 28545028
  4. Ssecretory STC1 enhances metastatic potential of hepatocellular carcinomas via JNK signaling. PMID: 28688970
  5. Glycolysis from glucose is regulated by hSTC-1, decreasing the adequate supply of glycerol-3-phosphate (G3P) needed for fatty acid esterification and triacylglycerol (TG) storage in brown adipose tissue (BAT). The decrease of TG capacity synthesis from glucose by hSTC-1 compromises the BAT thermogenic capacity. PMID: 28435144
  6. Increased STC1 plasma level represents a hallmark of late-onset preeclampsia; STC1 gene variants modulate placental gene expression and maternal hormone levels. PMID: 27603899
  7. Latanoprost-induced reduction of intraocular pressure is mediated through the downstream signaling molecule STC-1. When used by itself, STC-1 exhibits ocular hypotensive properties. PMID: 28538979
  8. Study demonstrates that STC1 is overexpressed in the prostate carcinoma cell lines and suggests that it promotes prostate carcinoma cell proliferation via cyclin E1/CDK2. PMID: 28350121
  9. In the fed state, STC1 increases the incorporation of (14)C from glucose into lipids in the white retroperitoneal adipose tissue (WRAT). STC1 is one of the hormonal factors that control glucose metabolism in WRAT in the fed state. PMID: 27730346
  10. STC1 protein is significantly up-regulated in midsecretory endometrial fluid and is dysregulated in eutopic endometrial tissue from women with endometriosis. It is likely regulated by cAMP and may be involved in the pathogenesis of decidualization defects. PMID: 27322879
  11. STC1 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  12. elevated STC-1 expression is associated with poor clinical outcome in triple-negative breast cancer (TNBC) patients, and STC-1 is directly involved in the invasiveness of TNBC cells PMID: 27461417
  13. we demonstrated that aberrant STC1 expression is associated with poor prognosis and stimulates the invasiveness of triplenegative breast cancer cells PMID: 27459971
  14. our findings strongly suggest that elevated expression of STC1 protein at the III-IV stage of lung adenocarcinoma promotes tumorigenesis of lung adenocarcinoma and positively associates with the cancer progression, which may be of potential value as tumor marker in clinical tracking lung adenocarcinoma progression. PMID: 26577859
  15. Data suggest that stanniocalcin 1 and 2 (STC1, STC2) participate in inhibition of proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) during folliculogenesis. PMID: 26874357
  16. STC1 gene expression at diagnosis might be a useful prognostic marker for clinical outcome and monitoring therapeutic response in patients with acute leukemia. PMID: 26547904
  17. STC1 blunts bleomycin-induced rise in thrombin protein and activity, diminishes thrombin-induced signaling through PAR1 to ERK, and inhibits bleomycin-induced pneumonitis. PMID: 26640170
  18. Data revealed the existence of a moderating effect between Klotho and STC1, where Klotho may inhibit thyroid tumor progression by inhibiting the tumor marker level of STC1. PMID: 26531219
  19. High expression levels of stanniocalcin-1 is associated with Hepatocellular Carcinoma. PMID: 26469082
  20. Results show that STC1 have an important role in the carbohydrate metabolism regulation, in particular gluconeogenesis from glutamine in the kidney, across the vertebrates. PMID: 26187698
  21. Stanniocalcin 1 is expressed in thyroid side population cells and thyroid cancer cells. PMID: 25647164
  22. Data show that co-transfection with cDNA encoding stanniocalcin-1 abrogates the proteolytic activity of pregnancy-associated plasma protein-A (PAPP-A) toward IGF-binding protein 4 (IGFBP-4). PMID: 26195635
  23. These findings demonstrate a role for STC1 in metastasis of early stage clear cell renal cell carcinoma. PMID: 25740019
  24. Mesenchymal stem cells correct inappropriate epithelial-mesenchyme relation in pulmonary fibrosis using Stc1. PMID: 25373521
  25. These results suggested that STC1 may be a valuable biomarker in diagnosing malignant degree of glioma and evaluating prognostic following surgery PMID: 25783529
  26. STC1 interferes with CALCRL signaling during osteoblastogenesis via adenylate cyclase inhibition. PMID: 25591908
  27. Stanniocalcin 1 downregulation is responsible for sorafenib-induced cardiotoxicity through activated ROS generation. PMID: 25370841
  28. Circulating STC1 and STC2 mRNA are potentially useful blood markers for LSCC PMID: 24743310
  29. This is the first study to show definitively that STC1 plays an oncogenic role in breast cancer, and indicates that STC1 could be a potential therapeutic target for treatment of breast cancer patients. PMID: 25391215
  30. High STC1 expression is associated with glioma. PMID: 24729417
  31. was indicated that secreted STC-1 promotes metastatic potential of breast cancer cells via activation of PI3K/AKT PMID: 25056605
  32. Stanniocalcin-1 and -2 promote angiogenic sprouting in HUVECs via VEGF/VEGFR2 and angiopoietin signaling pathways. PMID: 23664860
  33. An anti-apoptotic protein stanniocalcin-1 (STC-1) can prevent loss of retinal ganglion cells in the rat retina with optic nerve transection PMID: 23667669
  34. Data of this experiment showed that higher STC-1 expression during 96 h of preconditioning correlated with more effective MMP protection through the regulation of intracellular level of ROS and cytosolic free Ca2 + and preservation of cell viability. PMID: 23566487
  35. STC1 is differentially expressed in the culprit coronary plaques of patients with acute myocardial infarction versus those with stable angina. STC1 may play a role in plaque instability. PMID: 23757035
  36. Thus, these results provided evidence that STC1 inhibited cell proliferation and invasion through NF-kappaB p65 activation in cervical cancer. PMID: 23382863
  37. Data indicate that the secreted glycoprotein stanniocalcin-1 (STC1) as a mediator of metastasis by PDGF receptor function in the setting of colorectal cancer. PMID: 23243022
  38. STC-1 mRNA expression is a reliable marker for detection of DTCs in PB and BM of ESCC patients, and STC-1-positive DTCs may be a promising tool for diagnosis and prognosis assessment in ESCC. PMID: 22537917
  39. STC1 is a potentially useful blood marker for predicting biological tumor aggressiveness in patients with gastric cancer PMID: 22889960
  40. STC1 activates a novel anti-oxidant pathway in cardiac myocytes through induction of UCP3 PMID: 22693564
  41. Stanniocalcin (STC1) plays an important role in functional adaption in pediatric kidney transplantation. PMID: 22588538
  42. Overexpression of STC1 was an independent prognostic factor in patients with esophageal cancer who had undergone curative surgery. PMID: 22200953
  43. Level of circulating STC1 mRNA in NSCLC was significantly higher than in benign pulmonary disease or healthy volunteers. Higher levels of circulating STC1 mRNA were associated with more advanced tumor stages and histological subtypes. PMID: 21656524
  44. The results demonstrate that PKCalpha suppresses the expression of STC1 in breast cancer cells. PMID: 21720730
  45. STC-1 could promote angiogenesis in vitro and in vivo, and the angiogenesis was consistent with VEGF expression in vitro. Inhibition of VEGF expression in supernatants with neutralizing antibody markedly abolished angiogenesis induced by STC-1 in vitro. PMID: 21672207
  46. Vascular endothelial growth factor-D stimulates endothelial cell VEGF-A, stanniocalcin-1, and neuropilin-2 and has potent angiogenic effects. PMID: 21474827
  47. STC1 plays an important role in the early response to mechanical injury by epithelial cells by modulating signaling of extracellular ATP PMID: 20422040
  48. STC1 induction by thyroid hormone depends on both TRbeta and PI3K activation. PMID: 20827662
  49. High STC1 gene expression is associated with colorectal cancer. PMID: 21273618
  50. Human stanniocalcin-1 or -2 expressed in mice reduces bone size and severely inhibits cranial intramembranous bone growth. PMID: 20174869

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Stanniocalcin family
Tissue Specificity
Expressed in most tissues, with the highest levels in ovary, prostate, heart, kidney and thyroid. In the kidney, expression is confined to the nephron, specifically in the distal convoluted tubule and in the collecting tubule. Not detected in the brain, l
Database Links

HGNC: 11373

OMIM: 601185

KEGG: hsa:6781

STRING: 9606.ENSP00000290271

UniGene: Hs.25590

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*