Recombinant Human Store-operated calcium entry-associated regulatory factor (SARAF), partial

Code CSB-EP853392HU
Abbreviation Recombinant Human SARAF protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
SARAF
Uniprot No.
Research Area
Biochemicals
Alternative Names
FLJ22274; FOAP 7; HBV X transactivated gene 3 protein; HBV X-transactivated gene 3 protein; HBV XAg-transactivated protein 3; HSPC035; MGC8721; Protein FOAP 7; Protein FOAP-7; TMEM 66; Tmem66; TMM66_HUMAN; Transmembrane protein 66; XTP3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
195-339aa
Target Protein Sequence
SDGQYSPPPYSEYPPFSHRYQRFTNSAGPPPPGFKSEFTGPQNTGHGATSGFGSAFTGQQGYENSGPGFWTGLGTGGILGYLFGSNRAATPFSDSWYYPSYPPSYPGTWNRAYSPLHGGSGSYSVCSNSDTKTRTASGYGGTRRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.5kDa
Protein Length
Cytoplasmic Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Negative regulator of store-operated Ca(2+) entry (SOCE) involved in protecting cells from Ca(2+) overfilling. In response to cytosolic Ca(2+) elevation after endoplasmic reticulum Ca(2+) refilling, promotes a slow inactivation of STIM (STIM1 or STIM2)-dependent SOCE activity: possibly act by facilitating the deoligomerization of STIM to efficiently turn off ORAI when the endoplasmic reticulum lumen is filled with the appropriate Ca(2+) levels, and thus preventing the overload of the cell with excessive Ca(2+) ions.
Gene References into Functions
  1. SARAF also interacts with Orai1 and TRPC1 in cells endogenously expressing STIM1 and cells with a low STIM1 expression and modulates channel function. This review focuses on the modulation by SARAF of SOCE and other forms of Ca(2+) influx mediated by Orai1 and TRPC1 in order to provide spatio-temporally regulated Ca(2+) signals. PMID: 29223474
  2. This activation was sensitive to Src kinase inhibition, but not to CAMKII nor PKC inhibition, a result that sets STIM1 and SOCE as downstream targets of the axis Src-Raf-MEK-ERK, rather than upstream regulators. PMID: 28866365
  3. These findings suggest that the surface location of SARAF is dependent on the expression of STIM1 in the plasma membrane. PMID: 27414851
  4. SARAF modulates TRPC1, but not TRPC6, channel function in a STIM1-independent manner PMID: 27506849
  5. SARAF overexpression attenuated store operated Ca2+ entry and the STIM1-Orai1 interaction in cells endogenously expressing STIM1 and Orai1 while RNAi-mediated SARAF silencing induced opposite effects. PMID: 27068144
  6. SARAF is constitutively expressed in the plasma membrane and interacts with Orai1. PMID: 26817842
  7. Deletion of STIM1(448-490) and, in particular, STIM1(447-460) and STIM1(475-490) markedly enhances interaction of SARAF with STIM1. PMID: 23816623
  8. Store-operated Ca2+ entry is remodelled and controls in vitro angiogenesis in endothelial progenitor cells isolated from tumoral patients. PMID: 23049731
  9. Study shows that SARAF is an endoplasmic reticulum resident protein, which responds to cytosolic Ca2+ elevation after ER Ca2+ refilling by promoting a slow inactivation process of STIM2-dependent basal SOCE activity, as well as STIM1-mediated SOCE activity. PMID: 22464749

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note=Translocates to the endoplasmic reticulum-plasma membrane (ER-PM) region in a STIM1-dependent manner following cytosolic Ca(2+) elevation.; [Isoform 2]: Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Protein Families
SARAF family
Tissue Specificity
Highly expressed in macrophages.
Database Links

HGNC: 28789

OMIM: 614768

KEGG: hsa:51669

STRING: 9606.ENSP00000256255

UniGene: Hs.521487

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*