Recombinant Human Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 (SVEP1), partial

In Stock
Code CSB-EP689809HU
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
SVEP1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CCP module-containing protein 22;Polydom;Selectin-like osteoblast-derived protein;SEL-OB;Serologically defined breast cancer antigen NY-BR-38
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
736-827aa
Target Protein Sequence
GDFICTPDNTGVNCTLTCLEGYDFTEGSTDKYYCAYEDGVWKPTYTTEWPDCAKKRFANHGFKSFEMFYKAARCDDTDLMKKFSEAFETTLG
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
17.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May play a role in the cell attachment process.
Gene References into Functions
  1. Downregulation of SVEP1 expression in primary keratinocytes resulted in decreased expression of major epidermal differentiation markers. PMID: 27892606
  2. Top association findings suggested that the bipolar disorder risk allele at SNP rs7042161 in SVEP1 gene may be associated with increased risk of essential hypertension. PMID: 27529678
  3. We also found significant associations between coronary artery disease and low-frequency missense variants in the genes SVEP1. PMID: 26934567
  4. c.2080A>C SNP associated with increased 28-day mortality in septic shock PMID: 25188548
  5. polydom is a hitherto unknown ligand for integrin alpha9beta1 that functions as a physiological ligand in vivo. PMID: 22654117
  6. Increased UT-II, sTM, and vWF in ankylosing spondylitis patient sera regardless of treatment and disease activity suggest an increased tendency for atherosclerosis. PMID: 21556780
  7. acts as regulator of ICAM1 and E-selectin during endotoxemia PMID: 20236627
  8. All together makes SEL-OB/SVEP1 an attractive marker for studying the role of stromal osteogenic cells and their interactions within the bone marrow microenvironment creating a network that regulates the skeletal homeostasis. PMID: 16206243

Show More

Hide All

Subcellular Location
Secreted. Cytoplasm. Membrane; Peripheral membrane protein.
Tissue Specificity
Present in mesenchymal primary cultured cell lysates (at protein level). Highly expressed in placenta. Also expressed in marrow stromal cell. Weakly or not expressed in other tissues.
Database Links

HGNC: 15985

OMIM: 611691

KEGG: hsa:79987

STRING: 9606.ENSP00000384917

UniGene: Hs.522334

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*