Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP023528HU |
| Product Type | Recombinant Protein |
| Size | US$1726 |
| Uniprot No. | O95411 |
| Relevance | Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation. |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Alias | 12 kDa TGF-beta-1-induced antiapoptotic factor |
| Species | Homo sapiens (Human) |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Sequence | MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG |
| Research Area | Cell Biology |
| Source | E.coli |
| Gene Names | TIAF1 |
| Protein Names | Recommended name: TGFB1-induced anti-apoptotic factor 1 Alternative name(s): 12 kDa TGF-beta-1-induced antiapoptotic factor |
| Expression Region | 1-115aa |
| Tag Info | N-terminal GST-tagged |
| Mol. Weight | 39.4kDa |
| Protein Description | Full Length |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation. |
| Subcellular Location | Nucleus |
| Tissue Specificity | Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells. |
| Database Links |
HGNC: 11803 OMIM: 609517 KEGG: hsa:9220 STRING: 9606.ENSP00000352424 UniGene: Hs.462590 |
TIAF1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023528GA01HU | TIAF1 Antibody | Human | ELISA,WB |
TIAF1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023528ESR1HU | TIAF1 Antibody | Human | ELISA, IHC |
TIAF1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-YP023528HU CSB-BP023528HU CSB-MP023528HU |
Recombinant Human TGFB1-induced anti-apoptotic factor 1(TIAF1) | Yeast Baculovirus Mammalian cell |
TIAF1 ELISA Kit for Homo sapiens (Human)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL023528HU | Human TGFB1-induced anti-apoptotic factor 1(TIAF1) ELISA kit | serum, plasma, tissue homogenates, cell lysates | 3.9 pg/mL |
Recombinant Human Arylamine N-acetyltransferase 2(NAT2)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Peroxisome proliferator-activated receptor gamma(Pparg)
Express system: E.coli
Species: Mus musculus (Mouse)
Recombinant Human Secreted Ly-6/uPAR-related protein 1(SLURP1)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Clathrin heavy chain 2(CLTCL1) ,partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Mouse Transcriptional repressor CTCFL(Ctcfl)
Express system: E.coli
Species: Mus musculus (Mouse)
