Recombinant Human TGFB1-induced anti-apoptotic factor 1(TIAF1)

Code CSB-EP023528HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. O95411
Relevance Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 12 kDa TGF-beta-1-induced antiapoptotic factor
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG
Research Area Cell Biology
Source E.coli
Gene Names TIAF1
Protein Names Recommended name: TGFB1-induced anti-apoptotic factor 1 Alternative name(s): 12 kDa TGF-beta-1-induced antiapoptotic factor
Expression Region 1-115aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.4kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.
Subcellular Location Nucleus
Tissue Specificity Not detectable in normal kidney and liver. Up-regulated in chronic and acute allograft rejection: expressed in the inflammatory infiltrate and in tubular epithelial cells.
Database Links

HGNC: 11803

OMIM: 609517

KEGG: hsa:9220

STRING: 9606.ENSP00000352424

UniGene: Hs.462590

Related Products

TIAF1 Antibodies

TIAF1 Antibodies for Homo sapiens (Human)

TIAF1 Antibodies for Human

TIAF1 Proteins

TIAF1 Proteins for Homo sapiens (Human)

TIAF1 ELISA Kit

TIAF1 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.