Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

TNC

Uniprot No.

P24821

Research Area

Signal Transduction

Alternative Names

150 225; Cytotactin; Glioma associated extracellular matrix antigen; Glioma-associated-extracellular matrix antigen; GMEM; GP 150 225; GP 150-225; GP; Hexabrachion; HXB; JI; MGC167029; Miotendinous antigen; Myotendinous antigen; Neuronectin; TENA_HUMAN; Tenascin; Tenascin-C; Tenascin-C isoform 14/AD1/16; TenascinC; TN; TN C; TN-C; TNC

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1888-2201aa

Target Protein Sequence

DSPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGDNNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

39.5kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The preparation of this recombinant Human TNC protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a TNC fragment (1888-2201aa) that could be translated into the TNC protein and then transferred it into E.coli cells to express the recombinant TNC protein molecule. In order to get the target protein with high purity, N-terminal 6xHis tag was used in the production. The purity is 90% determined by SDS-PAGE.

Tenascin is an extracellular matrix protein with a spatially and temporally restricted tissue distribution. This protein is homohexameric with disulfide-linked subunits, and contains multiple EGF-like and fibronectin type-III domains. TNC level is undetectable in most adult tissues but rapidly and transiently induced by a handful of pro-inflammatory cytokines in a variety of pathological conditions including infection, inflammation, fibrosis, and wound healing. The increased deposition of TNC has been reported in the tumor stroma of most epithelial malignancies arising, for example, in the breast, uterus (both the cervix and body), ovary, prostate, pancreas, colon, stomach, mouth, larynx, lung, urinary tract, and skin. Interactions between epithelial (cancer) and stroma cells induce the expression of TNC by both cells, thereby facilitating the remodeling of cancer tissues. Deposited TNC in the cancer stroma modulates the cell behaviors of both cell types by interactions between cells and ECM that are mediated through integrins.

Target Background

Function

Extracellular matrix protein implicated in guidance of migrating neurons as well as axons during development, synaptic plasticity as well as neuronal regeneration. Promotes neurite outgrowth from cortical neurons grown on a monolayer of astrocytes. Ligand for integrins alpha-8/beta-1, alpha-9/beta-1, alpha-V/beta-3 and alpha-V/beta-6. In tumors, stimulates angiogenesis by elongation, migration and sprouting of endothelial cells.

Gene References into Functions

In addition, we found that Tn-expressing colorectal cancers (CRC) cell lines had either loss-of-function mutations in Cosmc or reversible Tn antigen expression, which was not caused by the deficiency of T-synthase activity PMID: 30115016
The results demonstrated that ANX2 and stromal tenascin C regulated invasion in addition to stemness and anoikis resistance, which are crucial for metastasis in the progression of pancreatic ductal adenocarcinoma. PMID: 29749431
Intratumor stromal expression of tenascin-C (TN-C) is a strong prognostic indicator in locally advanced unresectable (UR-LA) pancreatic ductal adenocarcinoma (PDAC) patients with resection after chemoradiotherapy (CRT). PMID: 29517632
this study shows that tenascin C is increased in vitiligo in lesional areas only in the acral sites PMID: 29605863
Data indicate three sites within tenascin-C that directly and cooperatively interact with toll-like receptor 4 (TLR4). PMID: 29150600
Results identify tenascin-C as an endogenous danger signal that is upregulated in systemic sclerosis and drives TLR4-dependent fibroblast activation, and by its persistence impedes fibrosis resolution. PMID: 27256716
Both fetal Tn-C variants may represent novel biomarkers that are capable of estimating both pulmonary vascular remodeling and right ventricular load. PMID: 29117120
high TNC expression correlates with worse prognosis for lung adenocarcinoma and has a role in lung cancer progressoin PMID: 28652369
Decellularized lung scaffolds treated with FBN-2 and TN-C prior to re-epithelialization supported greater epithelial proliferation and tissue remodeling. PMID: 28662401
Immunohistochemical analysis shows that the unique association between the CD44+/CD24low/- phenotype and the pronounced production of tenascin C may have a prognostic potential, prospectively indicating the inefficiency of neoadjuvant polychemotherapy (PCT), in particular that with platinum derivatives, which is used for the standard treatment of triple-negative BC. PMID: 29027523
Enhanced serum tenascin-C concentrations are closely related to trauma severity and clinical outcomes PMID: 28732652
Functional studies showed THBS1 and TNC to mediate chemoresistance through the integrin beta1/mTOR pathway. PMID: 27487140
Elevated Tenascin-C serum values are associated with non-small cell lung cancer. PMID: 26967391
Tenascin-C was abundantly secreted by the colon cancer cells with high metastatic potential, and highly expressed in lymph nodes with metastasis. PMID: 27191989
Intermittent hypoxia confers pro-metastatic gene expression selectively through NF-kappaB in inflammatory breast cancer cells, in particular, to tenascin-C and MPP9. PMID: 27717868
Metastatic prostate cancer cells cultured on osteo-mimetic surfaces coated with tenascin C exhibited enhanced adhesion and colony formation as mediated by integrin alpha9beta1. PMID: 28916657
Study showed that the proinflammatory, extracellular matrix glycoprotein tenascin-C from tissue damage and microbial lipopolysaccharide (LPS) from bacterial infection activated a common set of signaling pathways, including NF-kappaB and MAPK, but these stimuli also induced different signaling pathways downstream of TLR4. PMID: 27577261
High Tenacin C expression is associated with liver metastasis in colorectal cancer stroma. PMID: 29065427
Tenascin-C protein expression in this muscle was confined to arterioles and venules (80% of cases) and increased after training in A-allele carriers. Prior to training, volume densities of subsarcolemmal and myofibrillar mitochondria in m. vastus lateralis muscle were 49% and 18%, respectively, higher in A/A homozygotes relative to T-nucleotide carriers (A/T and T/T) PMID: 28384286
Study that recombinant TNC consisting of the epidermal growth factor (EGF-like repeats induced cerebral arterial constriction via EGF receptor and activation of ERK1/2 PMID: 27086972
Tenascin-C was abundant in cortical white and gray matter in brain tissue from Alzheimer's Disease patients. PMID: 27444354
secreted by transdifferentiated retinal pigment epithelial cells and promotes the development of choroidal neovascularization via integrin alphaV in a paracrine manner PMID: 27668890
Overexpression of TNC, SMA, and vimentin were significantly correlated with the lower overall survival in prostate cancer patients. PMID: 28341124
analysis of SNPs in tenascin-C (TNC) associated with degenerative rotator cuff tears PMID: 27248364
High TNC expression is associated with retinoblastoma. PMID: 27488116
prepartum and postpartum TN-C serum levels significantly higher in mild and severe preeclampsia than in healthy pregnancy PMID: 25567561
Tenascin-C overexpression in cancer cells and stromal fibroblasts was an independent poor prognostic factor for overall survival and disease-free survival esophageal squamous cell carcinoma patients. PMID: 26731558
Serum TNC levels are significantly raised and correlate with various clinical and laboratory variables of disease activity in children with enthesitis-related arthritis PMID: 25774061
This study has identified tenascin-C as a promoter of the invasiveness of brain tumor-initiating cells through a mechanism involving ADAM-9 proteolysis via the c-Jun NH2-terminal kinase pathway. PMID: 25646025
Co-expression of Matrix metalloproteinase-9 and Tenascin-C was associated with poorer prognosis and was found to be an independent predictor of survival PMID: 26652622
Studied the expression of TNC in tissue microarrays including 17 GBMs, 18 WHO grade III astrocytomas, 15 WHO grade II astrocytomas, 4 WHO grade I astrocytomas, and 7 normal brain tissue samples by immunohistochemical staining. PMID: 25469866
No difference in tenascin-C expression was found in COPD. PMID: 25794567
miR-133a enhances the protective capacity of cardiac progenitors cells after myocardial infarction PMID: 25448067
A pivotal role for TNC in tuning the local immune response to establish equilibrium between disseminated nodal cancer stem cells and the immune system. PMID: 25808872
lung cancer patients with Oct4 high, PTEN low and TNC high expression profile significantly correlated with poor disease-free survival PMID: 25609695
Circulating concentrations of Tn-C are higher in patients with a recent history of atherosclerotic stroke and may play an anti-inflammatory role by reducing pro-inflammatory cytokine release from atheroma. PMID: 24823872
Data indicate the expression of fetal ED-A(+) fibronectin and B (+) tenascin-C splicing variants in cardiac tissue from heart transplant recipients. PMID: 24792713
Tn-C and Gl-3 are promising markers for the diagnosis of pulmonary sarcoidosis, but they are not specific for cardiac involvement. PMID: 24777587
Subraracnoid hemorrhage, aneurysmal that is more severe induces more TNC, which may cause the subsequent development of both vasospasm and vasospasm-unrelated secondary brain injury, leading to ischemia. PMID: 25366610
The coated combination of TnC and TnR appeared to regulate neural differentiation signaling through integrin alpha7 and alpha9beta1 in bone marrow-derived human mesenchymal stem cells. PMID: 24829055
the fibronectin type III-like repeats in tenascin-C may be playing an important role in PCO. PMID: 25515583
Results found that Tenascin-C FNIIIA1 is over-expressed in osteosarcoma tissues and can promote MG-63 cell migration suggesting that high expression of A1 may promote metastasis of osteosarcoma. PMID: 24598996
Demonstrate that tenascin-C level is associated with pathologic conditions in acute coronary syndrome, especially the presence of ruptured plaque. PMID: 23532307
Interleukin-1-induced changes in the glioblastoma secretome suggest its role in tumor progression. PMID: 24503185
In conclusion, although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in breast cancer patients. PMID: 24696262
although serum TNC levels are elevated, it has no predictive or prognostic roles on survival in epithelial ovarian cancer patients. PMID: 24722824
Tenascin-C-derived peptide TNIIIA2 highly enhances cell survival and platelet-derived growth factor (PDGF)-dependent cell proliferation through potentiated and sustained activation of integrin alpha5beta1. PMID: 24808173
Studied serum levels of Tn-C containing the FNIIIB (B+ Tn-C) or FNIIIC (C+ Tn-C) domain in heart failure patients. Analysis of Tn-C concentrations according to heart failure etiology revealed no significant differences. PMID: 25016707
serum levels elevated in scleroderma PMID: 23834524
Serum levels of MMP-9, TIMP-1 and B(+) Tn-C and tissue levels of B(+) Tn-C and ED-A(+) Fn are promising markers for risk assessment in dilated cardiomyopathy. PMID: 23998545

Hide All

Involvement in disease

Deafness, autosomal dominant, 56 (DFNA56)

Subcellular Location

Secreted, extracellular space, extracellular matrix.

Protein Families

Tenascin family

Database Links

HGNC: 5318

OMIM: 187380

KEGG: hsa:3371

STRING: 9606.ENSP00000265131

UniGene: Hs.143250

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-RP115094h(C)
MSDS	MSDS
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP115094h(C) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TNC. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-RP115094h(C) could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) TNC.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Tenascin (TNC), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage