Recombinant Human Testisin (PRSS21)

In Stock Promotion
Code CSB-EP897592HU
Abbreviation Recombinant Human PRSS21 protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Eosinophil serine protease 1; ESP-1; ESP1 ; Prss21; Serine protease 21; TEST_HUMAN; TEST1; Testisin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
42-288aa
Target Protein Sequence
IVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCFETYSDLSDPSGWMVQFGQLTSMPSFWSLQAYYTRYFVSNIYLSPRYLGNSPYDIALVKLSAPVTYTKHIQPICLQASTFEFENRTDCWVTGWGYIKEDEALPSPHTLQEVQVAIINNSMCNHLFLKYSFRKDIFGDMVCAGNAQGGKDACFGDSGGPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNISHHFEWIQKLMAQS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
31.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Testisin (PRSS21) is expressed in E. coli and covers the full length of the mature protein from amino acids 42 to 288. The protein includes an N-terminal 6xHis tag that makes purification and detection more straightforward. SDS-PAGE analysis shows the product achieves greater than 90% purity, which appears to meet quality standards for research work. This is strictly a research-use-only product and should not be used for clinical or diagnostic purposes.

Testisin, known by the gene symbol PRSS21, is a serine protease that's mainly expressed in the male reproductive tract. It seems to play an important role in reproductive biology and cellular processes like proteolytic cascades. Researchers find testisin particularly interesting for studying cellular mechanisms and pathways involved in spermatogenesis and related biological functions. This likely makes it a useful tool for research in developmental biology and reproductive health, though the full scope of its functions may still be emerging.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The human Testisin is a serine protease that requires correct folding, disulfide bond formation, and potential glycosylation for enzymatic activity. E. coli, as a prokaryotic system, lacks eukaryotic chaperones and cannot perform glycosylation, making proper folding unlikely. The His tag may sterically interfere with the active site or protein interactions. Without experimental validation (e.g., protease activity assays), the protein cannot be assumed to be correctly folded or bioactive.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The His tag enables pull-down assays to identify binding partners, but if Testisin is misfolded, interactions may be non-physiological. The tag itself could cause artifactual binding. Validate any identified partners using native Testisin from eukaryotic sources (e.g., mammalian cells) to ensure relevance. Confirm protein folding before use.

2. Antibody Development and Validation

This application is suitable. The recombinant Testisin can serve as an immunogen for generating antibodies against linear epitopes, even if misfolded. The high purity supports consistent immunization. However, antibodies generated may not recognize conformational epitopes of native, correctly folded Testisin. Validate antibody specificity against endogenous Testisin in human tissues or cell lines.

3. Biochemical Characterization and Substrate Specificity Analysis

This application requires confirmed enzymatic activity. If Testisin is verified to be active (e.g., via protease assays with synthetic substrates), it can be used for kinetic studies and substrate specificity mapping. Without activity validation, data on enzyme kinetics are unreliable. First, perform a functional assay to confirm protease activity.

4. Inhibitor Screening and Development

Inhibitor screening is only feasible if Testisin is bioactive. An inactive protein will not yield meaningful results for inhibitor identification. Validate protease activity before high-throughput screening. The His tag facilitates immobilization, but ensures it does not interfere with inhibitor binding.

Final Recommendation & Action Plan

Before using this recombinant Testisin for any functional application, prioritize experimental validation of its folding and bioactivity. Start with a protease activity assay using a fluorogenic or chromogenic substrate (e.g., Z-FR-AMC) to confirm enzymatic function. If active, proceed with interaction, kinetic, or inhibitor studies; if inactive, limit use to non-functional applications like antibody production (with validation against native Testisin). For reliable results, consider expressing Testisin in a eukaryotic system (e.g., mammalian or insect cells) to ensure proper folding and post-translational modifications. Always include appropriate controls, such as native Testisin or known inhibitors, to ensure biological relevance.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Could regulate proteolytic events associated with testicular germ cell maturation.
Gene References into Functions
  1. Testisin activates PAR-2, inducing PAR-2 loss from the cell surface, internalization, and cellular signaling. PMID: 25519908
  2. Testisin may promote carcinogenesis by inhibiting tumor suppressor activity of maspin. PMID: 20211623
  3. Loss of Testisin is caused, at least in part, by DNA hypermethylation and histone deacetylation, and suggest a tumour suppressor role for Testisin in testicular tumorigenesis. PMID: 15685234
  4. The results demonstrate for the first time that aberrant methylation of specific CpG sites near the transcription initiation site is an important factor in testisin gene silencing in TGCT. PMID: 16810501
  5. These data suggest that aberrant regulation of PRSS21 may underlie certain secondary male infertility syndromes, such as "easily decapitated" spermatozoa in humans. PMID: 19571264

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor.
Protein Families
Peptidase S1 family
Tissue Specificity
Expressed predominantly in premeiotic testicular germ cells, mostly late pachytene and diplotene spermatocytes.
Database Links

HGNC: 9485

OMIM: 608159

KEGG: hsa:10942

STRING: 9606.ENSP00000005995

UniGene: Hs.72026

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*