Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Activity

Not Test

Target Names

LBX1

Uniprot No.

P52954

Research Area

Others

Alternative Names

Ladybird homeobox protein homolog 1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

170-281aa

Target Protein Sequence

ITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

18.6 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord.

Gene References into Functions

Two single nucleotide polymorphisms around LBX1 are associated with adolescent idiopathic scoliosis in a Northern Chinese Han population. PMID: 28187071
Meta-analysis provides evidence that rs111090870, rs678741 and rs625039 polymorphisms near LBX1 gene are associated with adolescent idiopathic scoliosis susceptibility in some populations.[meta-analysis] PMID: 27450593
LBX1 is a susceptibility gene for idiopathic scoliosis in a Scandinavian population. PMID: 25987191
In embryos overexpressing lbx1b, wnt5b, a ligand of the non-canonical Wnt/planar cell polarity (PCP) pathway, was significantly downregulated. PMID: 26820155
Our results identify two clinically relevant haplotypes in the LBX1-region with opposite effects on AIS risk. PMID: 25675428
Based on meta-analysis rs11190870 near LBX1 is likely a susceptibility variant for adolescent idiopathic scoliosis in East Asians. PMID: 24878781
Performed a meta-analysis of the LBX1 locus in six Asian and three non-Asian cohorts of adolescent idiopathic scoliosis (AIS) and found significant evidence for association of this locus with AIS susceptibility in all nine cohorts. PMID: 24721834
The SNP rs11190870 near LBX1 is associated with both susceptibility and curve progression of adolescent idiopathic scoliosis in Han Chinese adolescents. PMID: 23096252
This study shows that the genetic variants near the LBX1 gene are associated with adolescent idiopathic scoliosis susceptibility in Chinese Han population. PMID: 23308168
Single nucleotide polymorphism near LBX1 is significantly associated with adolescent idiopathic scoliosis in southern Chinese. PMID: 22301463
A genome-wide association study identifies common variants near LBX1 associated with adolescent idiopathic scoliosis PMID: 22019779
Ladybird homeobox 1 (LBX1), a developmentally regulated homeobox gene, directs expression of the known EMT inducers ZEB1, ZEB2, Snail1, and transforming growth factor beta2 (TGFB2). PMID: 19651985

Hide All

Subcellular Location

Nucleus.

Database Links

HGNC: 16960

OMIM: 604255

KEGG: hsa:10660

STRING: 9606.ENSP00000359212

UniGene: Hs.37128

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP012777HU
Abbreviation	Recombinant Human LBX1 protein, partial
MSDS	MSDS Datasheet
Size	$256
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Transcription factor LBX1 (LBX1), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage