Recombinant Human Transcription initiation factor IIA subunit 2(GTF2A2)

Code CSB-EP010000HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P52657
Relevance TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias General transcription factor IIA subunit 2 TFIIA p12 subunit
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Research Area Epigenetics and Nuclear Signaling
Source E.coli
Gene Names GTF2A2
Protein Names Recommended name: Transcription initiation factor IIA subunit 2 Alternative name(s): General transcription factor IIA subunit 2 TFIIA p12 subunit Short name= TFIIA-12 Short name= TFIIAS Transcription initiation factor IIA gam
Expression Region 1-109aa
Tag Info N-terminal GST-tagged
Mol. Weight 39.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.
Subcellular Location Nucleus
Protein Families TFIIA subunit 2 family
Database Links

HGNC: 4647

OMIM: 600519

KEGG: hsa:2958

STRING: 9606.ENSP00000379372

UniGene: Hs.512934

Related Products

GTF2A2 Antibodies

GTF2A2 Antibodies for Homo sapiens (Human)

GTF2A2 Antibodies for Human

GTF2A2 Proteins

GTF2A2 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.