Recombinant Human Transcription intermediary factor 1-alpha (TRIM24), partial

In Stock
Code CSB-EP024460HU
Abbreviation Recombinant Human TRIM24 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
E3 ubiquitin protein ligase TRIM24; E3 ubiquitin-protein ligase Trim24; hTIF1; PTC6; RING finger protein 82; RNF82; TF1A; TIF1 alpha; TIF1; TIF1-alpha; TIF1A; TIF1A_HUMAN; TIF1ALPHA; Transcription intermediary factor 1-alpha; Transcriptional intermediary factor 1 alpha; Transcriptional intermediary factor 1; Trim24; Tripartite motif containing 24; Tripartite motif-containing protein 24
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
891-1012aa
Target Protein Sequence
KKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
30.5kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional coactivator that interacts with numerous nuclear receptors and coactivators and modulates the transcription of target genes. Interacts with chromatin depending on histone H3 modifications, having the highest affinity for histone H3 that is both unmodified at 'Lys-4' (H3K4me0) and acetylated at 'Lys-23' (H3K23ac). Has E3 protein-ubiquitin ligase activity. Promotes ubiquitination and proteasomal degradation of p53/TP53. Plays a role in the regulation of cell proliferation and apoptosis, at least in part via its effects on p53/TP53 levels. Up-regulates ligand-dependent transcription activation by AR, GCR/NR3C1, thyroid hormone receptor (TR) and ESR1. Modulates transcription activation by retinoic acid (RA) receptors, including RARA. Plays a role in regulating retinoic acid-dependent proliferation of hepatocytes.
Gene References into Functions
  1. these results suggested that TRIM24 has an important role in the growth of Nasopharyngeal carcinoma (NPC). Additionally, silenced TRIM24 may lead to inhibited cell proliferation and induced cell apoptosis in NPC cells. PMID: 29749443
  2. TRIM24 is upregulated in HNSCC and promotes HNSCC cell growth and invasion through modulation of cell cycle, glucose metabolism, and GLUT3, making TRIM24 a potential oncoprotein in HNSCC. PMID: 29862279
  3. The findings identify TRIM24 as an oncogenic transcriptional co-activator in epidermal growth factor receptor-driven glioblastoma and also demonstrate a previously unknown signal relay by which H3K23ac/TRIM24 mediates epidermal growth factor receptor stimulation of STAT3 activation, thereby enhancing the oncogenic activity of the epidermal growth factor receptor/STAT3 pathway in human cancers. PMID: 29129908
  4. Results suggest that TRIM24 is a novel coactivator of the CAR that is involved in cell- and/or promoter- selective transactivation. PMID: 29101097
  5. TRIM24 expression was increased in human colorectal cancer and might be a novel prognostic biomarker. PMID: 28916426
  6. Study showed that TRIM24 was upregulated during gastric carcinogenesis and demonstrated that TRIM24 was a functional target gene of miR-511, and miR-511 inactivated PI3K/AKT and Wnt/beta-catenin pathways by suppressing TRIM24. PMID: 28114950
  7. we identified altered glucose metabolism in the progression of head and neck squamous cell carcinoma and showed that it could be partially attributed to the novel link between GLUT4 and TRIM24 PMID: 28061796
  8. This study concluded that reduced TRIM24 protein is associated with poor survival in esophageal squamous cell cancer (ESCC) patients, suggesting TRIM24 protein is a potential prognostic biomarker for ESCC. PMID: 27689360
  9. Data suggest that, in cardiomyocytes, TRIM32 attenuates activation of SRF signaling and hypertrophy due to dysbindin; TRIM24 promotes these effects. TRIM32 promotes dysbindin degradation; TRIM24 protects dysbindin from degradation. (TRIM = tripartite motif-containing protein; SRF = serum response factor) PMID: 28465353
  10. hypothesis of "synergistic modification induced recognition" is then proposed to link histone modification and TRIM24 binding PMID: 27079666
  11. Report provides evidence for an oncogenic role for TRIM24 as a transcriptional activator and mediator of hormone-refractory prostate cancer cell growth in SPOP mutant and castration-resistant prostate cells. PMID: 27238081
  12. TRIM24 expression is positively correlated with Acetylated H3 lysine 23 levels, and high levels of both TRIM24 and Acetylated H3 lysine 23 predict shorter overall survival of breast cancer patients. PMID: 27638829
  13. TRIM24 regulate resistance to Gefitinib via Akt pathway in non-small cell lung cancer cells. PMID: 26805734
  14. TRIM24 is overexpressed in human bladder cancer and facilitates bladder cancer growth and invasion, possibly through NF-kappaB and AKT signaling pathways. PMID: 25846736
  15. functions as an oncogene in colorectal carcinogenesis PMID: 25700357
  16. A role for TRIM24 in breast tumorigenesis through reprogramming of glucose metabolism in human mammary epithelial cells, further supporting TRIM24 as a viable therapeutic target in breast cancer. PMID: 25065590
  17. our study shows that TRIM24 is overexpressed in human gastric cancer and accelerates cell growth as well as induce chemoresistance PMID: 25724180
  18. Our results suggest that TRIM24 might serve as a potential prognostic marker and therapeutic target for the management of malignant gliomas. PMID: 24469053
  19. Study shows that TRIM24 is destabilized by ATM-mediated phosphorylation of TRIM24S768 in response to DNA damage, which disrupts TRIM24-p53 interactions and promotes the degradation of TRIM24. PMID: 24820418
  20. Overexpression of TRIM24 is associated with the onset and progress of human hepatocellular carcinoma. PMID: 24409330
  21. Upon TRIM24 silencing, the proliferation of HNSCC cells was notably inhibited due to the induction of apoptosis. PMID: 23717505
  22. TRIM24 plays an important role in NSCLC progression PMID: 22666376
  23. These results suggest that E4-ORF3 targets proteins for relocalization through a loosely homologous sequence dependent on accessibility. PMID: 22123502
  24. overexpression of the TRIM24/TIF-1alpha gene in breast cancer is associated with poor prognosis and worse surviva PMID: 21435435
  25. Aberrant expression of TRIM24 negatively correlates with survival of breast cancer patients. PMID: 21164480
  26. TRIM24 regulates AR-mediated transcription in collaboration with TIP60 and BRD7. PMID: 19909775
  27. Preferential expression of the HTIF1alpha gene in acute myeloid leukemia and MDS-related AML. Could play a role in myeloid differentiation, being distinctly regulated in hematopoietic lineages. PMID: 11986951
  28. TIF1alpha interacts with TIF1gamma and the coiled-coil region of TIF1gamma is necessary for this interaction. PMID: 12096914
  29. We propose that ZCCHC11 is a unique TLR signal regulator, which interacts with TIFA after LPS treatment and suppresses the TRAF6-dependent activation of NF-kappaB. PMID: 16643855
  30. We identified a novel interaction between E4 ORF3 and TIF1alpha PMID: 17287283

Show More

Hide All

Involvement in disease
A chromosomal aberration involving TRIM24/TIF1 is found in papillary thyroid carcinomas (PTCs). Translocation t(7;10)(q32;q11) with RET. The translocation generates the TRIM24/RET (PTC6) oncogene.
Subcellular Location
Nucleus. Cytoplasm. Note=Colocalizes with sites of active transcription. Detected both in nucleus and cytoplasm in some breast cancer samples. Predominantly nuclear.
Database Links

HGNC: 11812

OMIM: 603406

KEGG: hsa:8805

STRING: 9606.ENSP00000340507

UniGene: Hs.490287

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*