Name: Recombinant Human ER membrane protein complex subunit 4 (EMC4), partial
Brand: CUSABIO
SKU: 023887HU1

Product Details

Purity

>85% (SDS-PAGE)

Target Names

EMC4

Uniprot No.

Q5J8M3

Alternative Names

EMC4; TMEM85; HSPC184; PIG17; ER membrane protein complex subunit 4; Cell proliferation-inducing gene 17 protein; Transmembrane protein 85

Species

Homo sapiens (Human)

Protein Length

Partial

Tag Info

Tag type will be determined during the manufacturing process.

The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I am actually looking at two of your TMEM85 proteins: CSB-BP023887HU1 and CSB-EP023887HU1.
What are the expected molecular weights of these proteins? I will be using them as protein control for my Western blotting experiments.

Thanks for your reply. This is a twice transmembrane protein. We provide full length of mature protein in cell-free expression region, and partial protein in regular expression systems.
Partial protein:
Recombinant Human ER membrane protein complex subunit 4(EMC4),partial
CSB-YP023887HU1 >> Yeast
CSB-EP023887HU1 >> E.coli
Expression region: 2-83aa; partial protein.
Tag information: Tag type will be determined during the manufacturing process. (Please let us know if you have special request of tag, we will give priority to your needs. If the requested tag fail, we will provide other tagged protein. )
Sequence of target protein ( sequence of tag is not included):

TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMN

Full length protein:
Recombinant Human ER membrane protein complex subunit 4(EMC4)
CSB-CF023887HU
Expression region: 2-183aa; Full length of mature protein.
Tag information: Tag type will be determined during the manufacturing process. (Please let us know if you have special request of tag, we will give priority to your needs. If the requested tag fail, we will provide other tagged protein. )
Sequence of target protein ( sequence of tag is not included):

TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL

This protein is not in stock, it is semi-customized protein, we currently don't know the tag or vector, so cannot provide the molecular weight of fusion protein. Predicted molecular weight of target protein: 8885.01 Da.

Target Background

Function

Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).

Gene References into Functions

TMEM85 is a complex gene that encodes a novel conserved anti-apoptotic protein. PMID: 18586032

Subcellular Location

Endoplasmic reticulum membrane; Multi-pass membrane protein.

Protein Families

EMC4 family

Tissue Specificity

Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.

Database Links

HGNC: 28032

OMIM: 616245

KEGG: hsa:51234

STRING: 9606.ENSP00000267750

UniGene: Hs.250905

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-YP023887HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Yeast
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP023887HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-EP023887HU1-B
MSDS	MSDS Datasheet
Size	Pls inquire
Source	E.coli
Conjugate	Avi-tag Biotinylated E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-BP023887HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Baculovirus
Have Questions?	Leave a Message or Start an on-line Chat

Code	CSB-MP023887HU1
MSDS	MSDS Datasheet
Size	Pls inquire
Source	Mammalian cell
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human ER membrane protein complex subunit 4 (EMC4), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage