Recombinant Human ER membrane protein complex subunit 4 (EMC4), partial

Code CSB-YP023887HU1
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023887HU1
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023887HU1-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023887HU1
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023887HU1
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
EMC4
Uniprot No.
Alternative Names
EMC4; TMEM85; HSPC184; PIG17; ER membrane protein complex subunit 4; Cell proliferation-inducing gene 17 protein; Transmembrane protein 85
Species
Homo sapiens (Human)
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am actually looking at two of your TMEM85 proteins: CSB-BP023887HU1 and CSB-EP023887HU1.
What are the expected molecular weights of these proteins? I will be using them as protein control for my Western blotting experiments.

A:
Thanks for your reply. This is a twice transmembrane protein. We provide full length of mature protein in cell-free expression region, and partial protein in regular expression systems.
Partial protein:
Recombinant Human ER membrane protein complex subunit 4(EMC4),partial
CSB-YP023887HU1 >> Yeast
CSB-EP023887HU1 >> E.coli
Expression region: 2-83aa; partial protein.
Tag information: Tag type will be determined during the manufacturing process. (Please let us know if you have special request of tag, we will give priority to your needs. If the requested tag fail, we will provide other tagged protein. )
Sequence of target protein ( sequence of tag is not included):

TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMN


Full length protein:
Recombinant Human ER membrane protein complex subunit 4(EMC4)
CSB-CF023887HU
Expression region: 2-183aa; Full length of mature protein.
Tag information: Tag type will be determined during the manufacturing process. (Please let us know if you have special request of tag, we will give priority to your needs. If the requested tag fail, we will provide other tagged protein. )
Sequence of target protein ( sequence of tag is not included):

TAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTMMVCMMAWRPIQALMAISATFKMLESSSQKFLQGLVYLIGNLMGLALAVYKCQSMGLLPTHASDWLAFIEPPERMEFSGGGLLL


This protein is not in stock, it is semi-customized protein, we currently don't know the tag or vector, so cannot provide the molecular weight of fusion protein. Predicted molecular weight of target protein: 8885.01 Da.

Target Background

Function
Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
Gene References into Functions
  1. TMEM85 is a complex gene that encodes a novel conserved anti-apoptotic protein. PMID: 18586032
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Protein Families
EMC4 family
Tissue Specificity
Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.
Database Links

HGNC: 28032

OMIM: 616245

KEGG: hsa:51234

STRING: 9606.ENSP00000267750

UniGene: Hs.250905

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1