Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
Brain trypsinogen; Mesotrypsin; Mesotrypsinogen; MTG; Pancreatic trypsinogen III; Protease, serine, 3; Protease, serine, 4 (trypsin 4, brain); PRSS3; PRSS4; Serine protease 3; Serine protease 4; T9; TRY3; TRY3_HUMAN; TRY4; Trypsin 3; Trypsin III; Trypsin IV; Trypsin-3; Trypsinogen 4; Trypsinogen 5; Trypsinogen IV
Species
Homo sapiens (Human)
Expression Region
81-303aa
Target Protein Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAAN
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To make this Recombinant Human PRSS3 protein, the PRSS3 gene was isolated at first and cloned into an expression vector. CUSABIO has built a mature recombinant protein platform. This Recombinant Human PRSS3 protein was developed in the platform. It was expressed in E.coli at the region of 81-303aa of the Human PRSS3 protein. N-terminal 6xHis tag was fused with the expression vector for affinity and purification purposes. The purity is 90%+ determined by SDS-PAGE.
Serine protease 3 (PRSS3), one of the three major isoforms of trypsinogen, is a serine protease that is synthesized mainly in pancreatic acinar cells. It can be secreted into the small intestine to promote digestion. As a member of the serine protease family, PRSS3 is highly homologous to trypsinogen I and II (PRSS1 and PRSS2) at both the gene and protein levels. However, unlike PRSS1 and PRSS2, a small portion of pancreatic exocrine secretions is composed of PRSS3, which accounts for 3.0–10% of the trypsinogen content in normal pancreatic juice. The tumor specificity of trypsinogen has been elucidated in many types of tumors and it is thought to be involved in the development and progression of malignancies. PRSS3 is expressed in the airway epithelium and its active trypsin is detected in the lung bronchial epithelium, which might be related to its ability to activate various proteases in relation to coagulation, fibrinolysis, and/or inflammation. In non-small–cell lung cancer (NSCLC), the expression of PRSS3 is closely associated with metastasis and with a low prognosis for NSCLC patients. In addition, overexpression of PRSS3 in lung-cancer tissue results in increased migration across endothelial cells, thereby highlighting the potential role of trypsin in tumor metastasis. Taken together, PRSS3 plays an important role in the development and progression of many types of malignant tumors.
