Recombinant Human Tumor necrosis factor alpha-induced protein 8 (TNFAIP8)

Code CSB-RP119544h
Abbreviation Recombinant Human TNFAIP8 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
TNFAIP8
Uniprot No.
Research Area
Apoptosis
Alternative Names
GG2 1; Head and neck tumor and metastasis-related protein; MDC-3.13; NDED; NF-kappa-B-inducible DED-containing protein; SCC S2; SCC-S2; SCCS2; TFIP8_HUMAN; TNF alpha-induced protein 8; TNF induced protein; TNF-induced protein GG2-1; TNFAIP 8; TNFAIP8; Tumor necrosis factor alpha induced protein 8; Tumor necrosis factor alpha-induced protein 8
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-198aa
Target Protein Sequence
HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
Gene References into Functions
  1. TNFAIP8 regulates Hippo pathway through interacting with LATS1 to promote cell proliferation. PMID: 28926138
  2. The indel chr5:118704153:D, located within TNFAIP8, showed an association with plantar fascial disorders at genome-wide significance (p<5x10(-8)) with small effects (odds ratios=0.93 and 1.07 per allele, respectively). PMID: 29534260
  3. TNFAIP8 v2 may contribute to both carcinogenesis and chemotherapeutic resistance by broadly suppressing p53 activity, thus offsetting p53-dependent tumor suppression. PMID: 27834950
  4. TNFAIP8 seems to regulate the cell survival and cancer progression processes in a multifaceted manner. (Review) PMID: 27807832
  5. expression associated with cell survival and death in cancer cell lines infected with canine distemper virus PMID: 26373887
  6. induction of TNFAIP8 is critical for the evasion of apoptosis by tumor cells expressing the K120R variant of p53. PMID: 27341992
  7. Of these, three CpG sites on TNFAIP8 and PON1 genes (corresponding to: cg23917399; cg07086380; and cg07404485, respectively) were significantly differentially methylated between black and non-black individuals. The three CpG sites showed lower methylation status among infants of black women. PMID: 27000849
  8. TNFAIP8 regulates Hippo (MST1/2) signaling through its interaction with LATS1. PMID: 28152516
  9. TNFAIP8 overexpression is correlated with axillary lymph node metastasis and poor prognosis in invasive ductal breast carcinoma. PMID: 28087477
  10. that MicroRNA-9-TNFAIP8 might represent a promising diagnostic biomarker for gastric cancer patients and could be a potential therapeutic target in the prevention and treatment of gastric cancer PMID: 28127811
  11. these findings suggest that TNFAIP8 overexpression is a potential biomarker to identify pN0 esophageal squamous cell carcinoma patients at higher risk of lymphatic recurrence who may benefit from adjuvant therapy. PMID: 26886285
  12. Expression of TNFAIP8 is up-regulated in human gastric cancer and regulates cell proliferation, invasion and migration. PMID: 25936980
  13. Our data suggest that TNFAIP8 overexpression may contribute to lymph node metastasis and poor prognosis in intestinal-type gastric adenocarcinoma. PMID: 24621012
  14. TNFAIP8 may be used as a prognostic marker for the recurrence of endometrial cancer (EC), and its promotion of the proliferation and metastasis in EC may be due to its mediation of Ki-67 and MMP9. PMID: 24590269
  15. our findings indicate that TNFAIP8 overexpression is an independent predictor of platinum resistance in epithelial ovarian cancer PMID: 24767861
  16. SCC-S2 may play roles in affecting both immune cells and tumor cells in the thyroid and may indicate a novel pathway for understanding the pathogenesis of the disease. PMID: 24464924
  17. These results provide evidence that TNFAIP8 plays critical roles in non-small cell lung cancer PMID: 24136748
  18. the TNFAIP8-rs11064 Single nucleotide polymorphism may function by affecting the affinity of miR-22 binding to the 3'-untranslated region of TNFAIP8 and regulating TNFAIP8 expression, thus contributing to cervical cancer risk PMID: 23299407
  19. TNFAIP8 functions in oncogenesis are likely to involve activation of the integrin, MMP and VEGFR-2 signaling pathways. TNFAIP8 expression revealed correlation of both cytoplasmic and nuclear TNFAIP8 overexpression with high grade prostatic adenocarcinomas PMID: 23280553
  20. SCC-S2 is overexpressed in colon cancers. PMID: 22886548
  21. results showed stronger staining of TNFAIP8 protein in pancreatic cancer tissues compared with normal pancreas tissue; TNFAIP8 expression positively correlated with EGFR levels; results indicate TNFAIP8 may play important roles in the progression of pancreatic cancer PMID: 22631659
  22. polymorphism of TNFAIP8 rs1045241C>T may contribute to NHL susceptibility in a Chinese population PMID: 22666399
  23. Findings demonstrate that TNFAIP8 is one of critical components of a signal transduction pathway that links mesangial cell proliferation to diabetic renal injury. PMID: 20699119
  24. SCC-S2 plays an important role in NSCLC and might be a useful therapeutic target of NSCLC. PMID: 20398053
  25. SCC-S2 is a novel oncogenic factor in cancer cells PMID: 14724590
  26. A chicken ovalbumin upstream promoter transcription factor I (COUP-TFI) complex represses expression of the gene encoding tumor necrosis factor alpha-induced protein 8 (TNFAIP8). PMID: 19112178

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
TNFAIP8 family
Tissue Specificity
Expressed at high levels in the spleen, lymph node, thymus, thyroid, bone marrow and placenta. Expressed at high levels both in various tumor tissues, unstimulated and cytokine-activated cultured cells. Expressed at low levels in the spinal cord, ovary, l
Database Links

HGNC: 17260

OMIM: 612111

KEGG: hsa:25816

STRING: 9606.ENSP00000421848

UniGene: Hs.618488

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*