Recombinant Human Ubiquitin D (UBD)

Code CSB-EP025435HU
Abbreviation Recombinant Human UBD protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
UBD
Uniprot No.
Research Area
Cell Biology
Alternative Names
Diubiquitin; FAT10; GABBR1; UBD 3; Ubd; UBD_HUMAN; Ubiquitin D; Ubiquitin like protein FAT10; Ubiquitin-like protein FAT10
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-165aa
Target Protein Sequence
MAPNASCLCVHVRSEEWDLMTFDANPYDSVKKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVKPSDEELPLFLVESGDEAKRHLLQVRRSSSVAQVKAMIETKTGIIPETQIVTCNGKRLEDGKMMADYGIRKGNLLFLACYCIGG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.5kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ubiquitin-like protein modifier which can be covalently attached to target protein and subsequently leads to their degradation by the 26S proteasome, in a NUB1-dependent manner. Probably functions as a survival factor. Conjugation ability activated by UBA6. Promotes the expression of the proteasome subunit beta type-9 (PSMB9/LMP2). Regulates TNF-alpha-induced and LPS-mediated activation of the central mediator of innate immunity NF-kappa-B by promoting TNF-alpha-mediated proteasomal degradation of ubiquitinated-I-kappa-B-alpha. Required for TNF-alpha-induced p65 nuclear translocation in renal tubular epithelial cells (RTECs). May be involved in dendritic cell (DC) maturation, the process by which immature dendritic cells differentiate into fully competent antigen-presenting cells that initiate T-cell responses. Mediates mitotic non-disjunction and chromosome instability, in long-term in vitro culture and cancers, by abbreviating mitotic phase and impairing the kinetochore localization of MAD2L1 during the prometaphase stage of the cell cycle. May be involved in the formation of aggresomes when proteasome is saturated or impaired. Mediates apoptosis in a caspase-dependent manner, especially in renal epithelium and tubular cells during renal diseases such as polycystic kidney disease and Human immunodeficiency virus (HIV)-associated nephropathy (HIVAN).
Gene References into Functions
  1. the intrinsic instability of FAT10 together with its disordered N-terminus enables the rapid, joint degradation of FAT10 and its substrates. PMID: 30127417
  2. Overexpression of FAT10 promotes cisplatinresistant bladder cancer formation. These results indicated FAT10 may be a novel target for the treatment of bladder cancer. PMID: 29749526
  3. the results of the present study suggest that FAT10 may be involved in DDR and therefore the progression of tumorigenesis. PMID: 29620277
  4. Up-Regulation of UBD Transcript is associated with focal segmental glomerulosclerosis. PMID: 29531077
  5. FAT10 promotes tumor proliferation by directly stabilizing Survivin protein in breast cancer cells. PMID: 27806337
  6. our data suggest that FAT10 was upregulated via retinoic acid-induced protein I and NF-kappaB during H5N1 avian influenza virus infection. And the upregulated FAT10 promoted H5N1 viral replication by inhibiting type I IFN. PMID: 27354218
  7. we show how FAT10 stabilizes the translation elongation factor eEF1A1, which contributes to cancer cell proliferation PMID: 27312528
  8. this study revealed a novel function of LMO2 involving in the regulatory hierarchy of UBA6-USE1-FAT10ylation pathway by targeting the E1 enzyme UBA6. PMID: 27569286
  9. unlike ISG15, ubiquitin and FAT10 are conjugated to a similar degree to newly translated and pre-existing proteins. PMID: 27926780
  10. We also found that FAT10 may act its oncogenic functions through regulating HOXB9. Collectively, the results suggested that FAT10 may be a novel therapeutic target for osteosarcoma patients PMID: 27279480
  11. High expression of FAT10 is associated with glioma. PMID: 26733179
  12. Study demonstrates how the coordinated interplay of RIG-I, TRIM25, and FAT10 regulate the antiviral innate inflammatory response. PMID: 26996158
  13. Data suggest that ubiquitin D (UBD) provides a negative feedback on cytokine-induced activation of the endoplasmic reticulum to nucleus signaling 1 (IRE1alpha)/c-Jun N-terminal kinase (JNK) pro-apoptotic pathway in cytokine-exposed beta cells. PMID: 27044747
  14. FAT10 can induce malignant transformation as evidenced from the anchorage-independent growth as well as in vivo tumor-forming abilities of FAT10-overexpressing NeHepLxHT cells. PMID: 24325913
  15. repertoire of peptides eluted from MHC class I molecules was influenced by FAT10 expression PMID: 26401002
  16. FAT10 is the only ubiquitin-like modifier known to date which directly targets its hundreds of substrates for degradation by the proteasome. (Review) PMID: 25983082
  17. Conjugation of the ubiquitin activating enzyme UBE1 with the ubiquitin-like modifier FAT10 targets it for proteasomal degradation PMID: 25768649
  18. the interaction of FAT10 with MAD2 is a key mechanism underlying the promalignant property of FAT10 PMID: 25422469
  19. Results identified a novel HCC regulatory circuit involving FAT10, beta-catenin/TCF4, and HOXB9, the dysfunction of which drives invasive and metastatic character in HCC. PMID: 25056121
  20. STAT3 and NFkappaB synergistically act for maximum induction of FAT10 expression. PMID: 24518302
  21. transcription downregulation of the Ufm1 and FAT10 conjugation system in liver Mallory-Denk bodies formation PMID: 24893112
  22. functional distribution of the FAT10 targets suggests that FAT10 participates in various biological processes, such as translation, protein folding, RNA processing, and macromolecular complex assembly PMID: 23862649
  23. FAT10 expression in pancreatic ductal adenocarcinoma (PDAC) was an independent prognostic factor of patients, which might be a potential diagnostic and therapeutic target of PDAC PMID: 24492942
  24. These results suggest that knockdown of FAT10 by adenovirus-delivered siRNA may be a promising therapeutical strategy for treatment of hepatocellular carcinoma. PMID: 24440736
  25. FAT10 has a central role in regulating diverse aspects of the pathogenesis of hepatocellular carcinoma. PMID: 23812429
  26. FAT10 protects cardiac myocytes against apoptosis. PMID: 23416168
  27. Immunohistochemistry showed that FAT10 protein was over-expressed in glioma tissues. Expression level of FAT10 increase from grade I to grade IV glioma according to the results of real-time PCR, immunohistochemistry analysis and Western blot. PMID: 22402871
  28. p62 becomes covalently mono-FAT10ylated at several lysines, and FAT10 colocalizes with p62 in p62 bodies. PMID: 22797925
  29. FATylation of LRRFIP2 occurs on two distinct sites, each being modified by a single FAT10 moiety. PMID: 23036196
  30. These data reveal that VHS domain of Stam2 enters the hydrophobic pocket of K48-linked diubiquitin and binds the two ubiquitin subunits with different affinities. PMID: 21121635
  31. This study identified eEF1A1 as a FAT10-specific binding protein, and when the expression of FAT10 was reduced by siRNA knockdown, this resulted in downregulation of eEF1A1 expression in hepatoma cells. PMID: 22569823
  32. FAT10 modification of the HCMV-derived antigen pp65 (FAT10-pp65) enhances the presentation of the HLA-A2-restricted pp65495-509 antigenic peptide and provide evidence that FAT10- pp65 differs from Ub-modified pp65 in using the proteasome machinery. PMID: 22349260
  33. Ten SNPs in FAT10 were identified. PMID: 22292662
  34. Data indicate the potential role of cytokine-induced FAT10 expression in regulating Uba6 pathways. PMID: 22427669
  35. findings show how FAT10 and NUB1L dock with the 26S proteasome to initiate proteolysis; identified the 26S proteasome subunit hRpn10/S5a as the receptor for FAT10, whereas NUB1L can bind to both Rpn10 and Rpn1/S2. PMID: 22434192
  36. implicate FAT10 in retinal cell biology and Leber congenital amaurosis pathogenesis, and reveal a new role of AIPL1 in regulating the FAT10 pathway. PMID: 22347407
  37. In this study a crystal structure of linear diubiquitin at a resolution of 2.2 A degrees is reported. PMID: 22281738
  38. Degradation of FAT10 is accelerated after induction of apoptosis, suggesting that it plays a role in prosurvival pathways PMID: 22072791
  39. FAT10 plays an important role in mediating the function of TNF-alpha during tumorigenesis by inducing cell cycle deregulation and chromosomal instability. PMID: 22025632
  40. An extract of bark from the tropical rainforest plant Byrsonima crassifolia was screened for inhibition of diubiquitin formation by the human ubiquitin-conjugating enzyme E2-25K. PMID: 22164771
  41. Data indicate that the 20,000-bp region is telomeric of the UBD gene and contains LOC729653, a hypothetical gene. PMID: 21631897
  42. new role for FAT10 in the pathogenesis of polyglutamine diseases. PMID: 21757738
  43. The p53 transcriptional activity was found to be substantially enhanced in FAT10-overexpressing cells. PMID: 21396347
  44. USE1 is not only the first E2 enzyme but also the first known substrate of FAT10 conjugation, as it was efficiently auto-FAT10ylated in cis but not in trans. PMID: 20975683
  45. Genetic polymorphism in UBD is associated with colorectal cancer. PMID: 21351261
  46. Reverse transcriptase-polymerase chain reaction analysis of intestinal biopsy sample pairs (at diagnosis vs treated) from 30 celiac disease patients confirmed overexpression of UBD in active disease tissue. PMID: 19808075
  47. FAT10 may modulate tumorigenesis through its reported interaction with the MAD2 spindle-assembly checkpoint protein. PMID: 12730673
  48. FAT10 is degraded by the proteasome in ubiqitin-independent manner. PMID: 15831455
  49. high levels of FAT10 protein in cells lead to increased mitotic nondisjunction and chromosome instability, which is mediated by an abbreviated mitotic phase and reduction in the kinetochore localization of MAD2 during prometaphase PMID: 16495226
  50. Immunohistochemical studies demonstrated increased FAT10 expression in HIV-associated nephropathy and in autosomal dominant polycystic kidney disease. PMID: 16495380

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Accumulates in aggresomes under proteasome inhibition conditions.
Tissue Specificity
Constitutively expressed in mature dendritic cells and B-cells. Mostly expressed in the reticuloendothelial system (e.g. thymus, spleen), the gastrointestinal system, kidney, lung and prostate gland.
Database Links

HGNC: 18795

OMIM: 606050

KEGG: hsa:10537

STRING: 9606.ENSP00000366249

UniGene: Hs.44532

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*