Recombinant Human Valacyclovir hydrolase (BPHL)

In Stock Promotion
Code CSB-YP774821HU(F1)
Abbreviation Recombinant Human BPHL protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
BPHL
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Biphenyl hydrolase like ; Biphenyl hydrolase related ; biphenyl hydrolase-like (serine hydrolase); Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; BPHL_HUMAN; Bphrp; Breast epithelial mucin associated antigen ; Breast epithelial mucin-associated antigen; MCNAA; Mucin-associated antigen; VACVase; Valacyclovir hydrolase; Valacyclovirase
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
38-291aa
Target Protein Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Valacyclovir hydrolase (BPHL) is produced in a yeast expression system, spanning the full length of the mature protein from amino acids 38 to 291. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates purity levels above 90%, suggesting it may be suitable for various research applications.

Valacyclovir hydrolase, also known as BPHL, appears to play a critical role in activating antiviral prodrugs. This enzyme handles the hydrolysis of valacyclovir to its active form, acyclovir—a conversion that seems crucial for therapeutic efficacy. BPHL participates in drug metabolism pathways and has drawn considerable interest in pharmacological research, particularly for optimizing antiviral treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant BPHL protein cannot be assumed to be correctly folded or bioactive without experimental validation. BPHL is a hydrolytic enzyme that requires precise tertiary structure formation for its catalytic activity, particularly around the active site responsible for valacyclovir hydrolysis. While the yeast expression system provides eukaryotic folding machinery and the protein represents the full-length mature sequence (38-291aa), the dual tagging system (N-terminal 10xHis and C-terminal Myc) presents significant folding risks. Both tags, especially when combined, may cause steric hindrance that disrupts the native protein structure, potentially affecting active site accessibility or dimerization interfaces (if applicable). The C-terminal Myc tag is particularly concerning as it may interfere with proper folding completion. The purity >90% indicates minimal contaminants, but does not guarantee correct folding. Without validation through enzymatic activity assays and structural characterization, the protein's functional status remains uncertain.

1. Enzyme Kinetics and Substrate Specificity Studies

This recombinant BPHL can be used for enzymatic studies only if correct folding and bioactivity are experimentally verified. The dual tags may alter the active site conformation or substrate access, leading to inaccurate kinetic parameters (Km, Vmax). If misfolded, activity measurements would be invalid. It is essential to first confirm hydrolytic activity against valacyclovir using a validated assay before quantitative kinetic studies. Tag removal may be necessary for reliable results.

2. Protein-Protein Interaction Studies

The dual-tagged BPHL can be employed in interaction studies, but detected partners may reflect tag-mediated artifacts rather than biological interactions. The tags (especially the larger 10xHis) may promote non-specific binding or mask authentic interfaces. For valid results, validate folding first and include rigorous controls (e.g., tag-only baits). The Myc tag enables detection but does not ensure native conformation for interactions

3. Antibody Development and Validation

This recombinant BPHL can generate antibodies, but the dual tags may dominate the immune response, resulting in antibodies that primarily recognize tags rather than BPHL-specific epitopes. If misfolded, antibodies may not recognize native BPHL. For specific antibodies, validate using tag-free BPHL or confirm recognition of endogenous protein. The Myc tag serves as a control but does not guarantee BPHL-specific antibody quality.

4. Structural and Biophysical Characterization

The protein is unsuitable for high-resolution structural studies without tag removal, as both tags introduce flexibility and heterogeneity. Biophysical techniques (e.g., circular dichroism) can assess general folding but may be confounded by tag contributions. For meaningful insights, remove tags and validate native-like structure through activity assays first. The yeast expression system supports folding but cannot overcome tag-induced artifacts.

5. Drug Metabolism Research Models

This recombinant BPHL can model drug metabolism only if enzymatic activity is confirmed. The dual tags may alter substrate specificity or catalytic efficiency, leading to misleading metabolism patterns. For reliable prodrug metabolism studies, verify activity with known substrates and consider tag removal. Without validation, results may not reflect physiological enzyme behavior.

Final Recommendation & Action Plan

To ensure reliable outcomes, first validate the folding and bioactivity of the recombinant BPHL through enzymatic activity assays using valacyclovir or a known substrate, coupled with structural analysis (e.g., circular dichroism for secondary structure). Given the potential interference from dual tags, consider tag removal via proteolytic cleavage (if cleavage sites are present) and re-purify the tag-free protein for functional studies. For applications like antibody development, use the current protein but validate resulting antibodies against native BPHL. Always include appropriate controls in experiments, such as tag-free proteins or catalytically inactive mutants, to account for potential artifacts. Priority should be given to enzymatic validation before any quantitative application.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Protein Families
AB hydrolase superfamily, Lipase family
Tissue Specificity
Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
Database Links

HGNC: 1094

OMIM: 603156

KEGG: hsa:670

STRING: 9606.ENSP00000369739

UniGene: Hs.10136

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*