Recombinant Human Valacyclovir hydrolase (BPHL)

In Stock
Code CSB-YP774821HU(F1)
Abbreviation Recombinant Human BPHL protein
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
BPHL
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Biphenyl hydrolase like ; Biphenyl hydrolase related ; biphenyl hydrolase-like (serine hydrolase); Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; BPHL_HUMAN; Bphrp; Breast epithelial mucin associated antigen ; Breast epithelial mucin-associated antigen; MCNAA; Mucin-associated antigen; VACVase; Valacyclovir hydrolase; Valacyclovirase
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
38-291aa
Target Protein Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Valacyclovir hydrolase (BPHL) is produced in a yeast expression system, spanning the full length of the mature protein from amino acids 38 to 291. The protein comes with an N-terminal 10xHis-tag and a C-terminal Myc-tag, which makes purification and detection more straightforward. SDS-PAGE analysis indicates purity levels above 90%, suggesting it may be suitable for various research applications.

Valacyclovir hydrolase, also known as BPHL, appears to play a critical role in activating antiviral prodrugs. This enzyme handles the hydrolysis of valacyclovir to its active form, acyclovir—a conversion that seems crucial for therapeutic efficacy. BPHL participates in drug metabolism pathways and has drawn considerable interest in pharmacological research, particularly for optimizing antiviral treatments.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Enzyme Kinetics and Substrate Specificity Studies

This recombinant BPHL protein can help characterize the enzymatic properties of valacyclovir hydrolase through in vitro biochemical assays. Researchers might determine kinetic parameters like Km, Vmax, and kcat using valacyclovir and other potential substrates under controlled reaction conditions. The high purity (>90%) should provide reliable quantitative measurements of enzyme activity. These studies could offer fundamental insights into the catalytic mechanism and substrate preferences of this human enzyme.

2. Protein-Protein Interaction Studies

The dual-tagged design of this protein (N-terminal His-tag and C-terminal Myc-tag) makes it potentially useful for investigating protein interactions through pull-down assays and co-immunoprecipitation experiments. The His-tag allows immobilization on nickel-based resins for capturing interacting partners from cell lysates or purified protein mixtures. Meanwhile, the Myc-tag provides another option for detection and validation of interactions using anti-Myc antibodies in Western blotting or immunofluorescence applications.

3. Antibody Development and Validation

This purified recombinant protein serves as a promising antigen for generating specific antibodies against human BPHL. The high purity level suggests that resulting antibodies will likely have minimal cross-reactivity with contaminants. Researchers can use the protein for immunizing animals, screening hybridomas, and validating antibody specificity through ELISA, Western blotting, and other immunoassays—with the incorporated Myc-tag acting as a positive control.

4. Structural and Biophysical Characterization

The recombinant BPHL protein appears suitable for biophysical studies aimed at understanding its structural properties and stability. Techniques like circular dichroism spectroscopy, dynamic light scattering, and thermal stability assays may provide insights into protein folding, secondary structure content, and conformational changes under different conditions. The yeast expression system typically produces properly folded eukaryotic proteins, which makes this preparation likely appropriate for structural studies.

5. Drug Metabolism Research Models

This recombinant enzyme can serve as a research tool for studying the metabolism of valacyclovir and structurally related compounds in controlled in vitro systems. Researchers might investigate the hydrolysis patterns of various prodrugs and examine how different chemical modifications affect substrate recognition and processing. Studies like these contribute to understanding human drug metabolism pathways and could inform medicinal chemistry research on prodrug design strategies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Protein Families
AB hydrolase superfamily, Lipase family
Tissue Specificity
Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
Database Links

HGNC: 1094

OMIM: 603156

KEGG: hsa:670

STRING: 9606.ENSP00000369739

UniGene: Hs.10136

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*