Recombinant Human Valacyclovir hydrolase (BPHL)

In Stock
Code CSB-EP774821HU(F1)
Abbreviation Recombinant Human BPHL protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
BPHL
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Biphenyl hydrolase like ; Biphenyl hydrolase related ; biphenyl hydrolase-like (serine hydrolase); Biphenyl hydrolase-like protein; Biphenyl hydrolase-related protein; Bph-rp; Bphl; BPHL_HUMAN; Bphrp; Breast epithelial mucin associated antigen ; Breast epithelial mucin-associated antigen; MCNAA; Mucin-associated antigen; VACVase; Valacyclovir hydrolase; Valacyclovirase
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
38-291aa
Target Protein Sequence
SVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Discover our Recombinant Human BPHL protein, meticulously engineered for researchers focused on signal transduction. This full-length Valacyclovir hydrolase (VACVase; Valacyclovirase; Biphenyl hydrolase-like protein) is produced in an E.coli expression system, covering the 38-291aa expression region to provide the complete mature protein sequence. The BPHL protein is N-terminal 10xHis-tagged and C-terminal Myc-tagged, allowing for simplified purification and detection processes, ensuring consistent performance and reliable results in your experiments.

With a purity greater than 85% as determined by SDS-PAGE, our Recombinant Human BPHL protein is available in both liquid and lyophilized powder forms. Rely on this high-quality protein to support your signal transduction research and provide dependable, reproducible outcomes.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine hydrolase that catalyzes the hydrolytic activation of amino acid ester prodrugs of nucleoside analogs such as valacyclovir and valganciclovir. Activates valacyclovir to acyclovir. May play a role in detoxification processes. It is a specific alpha-amino acid ester hydrolase that prefers small, hydrophobic, and aromatic side chains and does not have a stringent requirement for the leaving group other than preferring a primary alcohol.
Protein Families
AB hydrolase superfamily, Lipase family
Tissue Specificity
Expressed at high levels in liver and kidney and lower levels in heart, intestine and skeletal muscle.
Database Links

HGNC: 1094

OMIM: 603156

KEGG: hsa:670

STRING: 9606.ENSP00000369739

UniGene: Hs.10136

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*