Recombinant Human WD repeat-containing protein 1 (WDR1), partial

Code CSB-EP025995HU1
Abbreviation Recombinant Human WDR1 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
WDR1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Actin interacting protein 1; Actin-interacting protein 1; AIP1; D5Wsu185e; NORI 1; NORI-1; WD repeat domain 1; WD repeat-containing protein 1; wdr1; WDR1_HUMAN
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
189-461aa
Target Protein Sequence
HKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKGPVTDVAYSHDGAFLAVCDASKVVTVFSVADGYSENNVFYGHHAKIVCLAWSPDNEHFASGGMDMMVYVWTLSDPETRVKIQDAHRLHHVSSLAWLDEHTLVTTSHDASVKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
56.4kDa
Protein Length
Partial of Isoform 2
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Induces disassembly of actin filaments in conjunction with ADF/cofilin family proteins. Enhances cofilin-mediated actin severing. Involved in cytokinesis. Involved in chemotactic cell migration by restricting lamellipodial membrane protrusions. Involved in myocardium sarcomere organization. Required for cardiomyocyte growth and maintenance. Involved in megakaryocyte maturation and platelet shedding. Required for the establishment of planar cell polarity (PCP) during follicular epithelium development and for cell shape changes during PCP; the function seems to implicate cooperation with CFL1 and/or DSTN/ADF. Involved in the generation/maintenance of cortical tension. Involved in assembly and maintenance of epithelial apical cell junctions and plays a role in the organization of the perijunctional actomyosin belt.
Gene References into Functions
  1. STAT3 bound to the 5' upstream sequence (-1971 to -1964), a putative promoter region, of WDR1 gene, and its activation induced WDR1 overexpression in breast cancer cells. PMID: 27521604
  2. MRTF-A-miR-206-WDR1 form feedback loop to regulate breast cancer cell migration. PMID: 28822708
  3. homozygous missense L153F/L293F mutation in the actin regulatory gene WDR1 causes a new autoinflammatory disease in humans, with periodic fevers, immunodeficiency, and intermittent thrombocytopenia (PFIT). PMID: 27994071
  4. These data suggest that WDR1 plays an important role in suppressing platelet activity, where it alters the actin cytoskeleton dynamics, and downregulation of WDR1 may contribute to the platelet-mediated pathogenesis of cardiovascular disease. PMID: 27609643
  5. Mutations in WDR1 affect neutrophil morphology, motility, and function, causing a novel primary immunodeficiency PMID: 27557945
  6. A/A" genotype of rs12498927 was associated with increased risk of gout. PMID: 27173277
  7. Identify positive correlations between WDR1 and CLNK gene polymorphisms in Chinese-Tibetan gout populations. PMID: 26438387
  8. Demonstrate a previously unanticipated role of Aip1 in regulating the structure and remodeling of intestinal epithelial junctions and early steps of epithelial morphogenesis. PMID: 25792565
  9. When maternal environmental tobacco smoke was considered, fifteen of 135 single nucleotide polymorphism (SNPs) mapping to SLC2A9 and 9 of 59 SNPs in WDR1 gave P values approaching genome-wide significance. PMID: 24516586
  10. Data suggest that anti-WD repeat domain 1 (WDR1) antibody could be applied for serological screening of papillary thyroid carcinoma (PTC) and undifferentiated thyroid carcinoma (UTC), and could be an efficient and inexpensive biomarker. PMID: 23215816
  11. WD repeat-containing protein 1 was confirmed as being significantly overexpressed in interstitial fluid from ovarian carcinomas compared to healthy ovarian tissue. PMID: 23707566
  12. Studies suggest that vascular endothelial growth factor may be responsible for upregulated P-glycoprotein expression. PMID: 23293323
  13. The QKI RNA-binding proteins regulate oligodendrocyte differentiation by modulating the expression of AIP-1. PMID: 20631256
  14. Studies indicate that CUL4 uses a large beta-propeller protein, DDB1, as a linker to interact with a subset of WD40 proteins. PMID: 19818632
  15. AIP1/WDR1 could abort the severing/disassembly activity somewhat still carried out due to phosphorylated ADF/cofilin PMID: 15629458
  16. Data indicates that Aip1 plays an important role in directional cell migration by restricting the stimulus-induced membrane protrusion to one direction via promoting cofilin activity. PMID: 18494608
  17. Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia. PMID: 19165527

Show More

Hide All

Subcellular Location
Cytoplasm. Cytoplasm, cytoskeleton. Cell projection, podosome. Cell junction.
Protein Families
WD repeat AIP1 family
Tissue Specificity
Expressed in peripheral blood mononuclear cells (at protein level).
Database Links

HGNC: 12754

OMIM: 604734

KEGG: hsa:9948

STRING: 9606.ENSP00000427687

UniGene: Hs.128548

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*