Recombinant Human Transcriptional coactivator YAP1(YAP1)

In Stock
Code CSB-YP026244HU
Product Type Recombinant Protein
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P46937
Lead Time 3-7 business days
Relevance Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Plays a key role to control cell proliferation in response to cell contact. Phosphorylation of YAP1 by LATS1/2 inhibits its translocation into the nucleus to regulate cellular genes important for cell proliferation, cell death, and cell migration. The presence of TEAD transcription factors are required for it to stimulate gene expression, cell growth, anchorage-independent growth, and epithelial mesenchymal transition (T) induction. Isoform 2 and isoform 3 can activate the C-terminal fragment (CTF) of ERBB4 (isoform 3).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Protein yorkie homologYes-associated protein YAP65 homolog
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Research Area Cancer
Source Yeast
Gene Names YAP1
Protein Names Recommended name: Yorkie homologAlternative name(s): 65 kDa Yes-associated protein Short name= YAP65
Expression Region 1-504aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 56.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis
Involvement in disease Coloboma, ocular, with or without hearing impairment, cleft lip/palate, and/or mental retardation (COB1)
Subcellular Location Cytoplasm, Nucleus
Protein Families YAP1 family
Tissue Specificity Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).
Database Links

HGNC: 16262

OMIM: 120433

KEGG: hsa:10413

STRING: 9606.ENSP00000282441

UniGene: Hs.503692

Pathway Hippo signaling pathway

Q&A and Customer Reviews

Q&A
Q:

For item CSB-YP026244HU, would you please verify the buffer? We need a product without Imidazole.

A:
Thanks for your inquiry.
When separating and purifying the protein, we use imidazole for elution. We can remove the imidazole as much as possible by dialysis, but we can't guarantee that there is no residue at all.
If you care about imidazole, please remark this request when sending the PO and we will try to remove the imidazole by dialysis as much as possible.
(We generally use a concentration of 200 mM - 500 mM imidazole to elute, which should be removed after dialysis.)
Please do not hesitate to contact us if you have further questions. Nice day.
Q:

I am interested in this protein but they are wondering if it’s possible to obtain the elute in 20% glycerol instead of 50%? If this is possible, can you please tell me the size and cost to LifeSpan?

A:
Thanks for your inquiry. CSB-YP026244HU Recombinant Human Yorkie homolog(YAP1)
The delivery form is liquid. The storage buffer is 20 mM Tris-HCl, 0.5M NaCl, pH 8.0, 20% glycerole.
We could satisfy the your requirement for the glycerole content. Any more questions, feel free to contact us.
Customer Reviews

Related Products

YAP1 Antibodies

YAP1 Antibodies for Homo sapiens (Human)

YAP1 Proteins

YAP1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.