Recombinant Human Transcriptional coactivator YAP1(YAP1)

In Stock
Code CSB-YP026244HU
Size US$1298Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names YAP1
Uniprot No. P46937
Research Area Cancer
Alternative Names 65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP-1; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-504aa
Target Protein Sequence MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 56.5kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Q&A and Customer Reviews

 Q&A
Q:

For item CSB-YP026244HU, would you please verify the buffer? We need a product without Imidazole.

A:
Thanks for your inquiry.
When separating and purifying the protein, we use imidazole for elution. We can remove the imidazole as much as possible by dialysis, but we can't guarantee that there is no residue at all.
If you care about imidazole, please remark this request when sending the PO and we will try to remove the imidazole by dialysis as much as possible.
(We generally use a concentration of 200 mM - 500 mM imidazole to elute, which should be removed after dialysis.)
Please do not hesitate to contact us if you have further questions. Nice day.
Q:

I am interested in this protein but I'm wondering if it’s possible to obtain the elute in 20% glycerol instead of 50%? If this is possible, can you please tell me the size and cost?

A:
Thanks for your inquiry. CSB-YP026244HU Recombinant Human Yorkie homolog(YAP1)
The delivery form is liquid. The storage buffer is 20 mM Tris-HCl, 0.5M NaCl, pH 8.0, 20% glycerole.
We could satisfy the your requirement for the glycerole content. Any more questions, feel free to contact us.
 Customer Reviews

Target Data

Function Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis
Gene References into Functions
  1. Studies indicate that the transcriptional co-activators YAP and TAZ recently emerged as key mediators of the biological effects that are observed in response to extracellular matrix (ECM) elasticity and cell shape. PMID: 22895435
  2. loss of p53 or LKB1 relieves DVL-linked reciprocal inhibition between the Wnt and nuclear YAP activity PMID: 29895829
  3. that lncRNA B4GALT1-AS1 promotes OS cells stemness and migration via recruiting HuR to enhance YAP activity PMID: 30182452
  4. The miR-590-5p/YAP axis may be an important novel mechanism in the pathogenesis of CD and colorectal cancer. PMID: 29912317
  5. The observed decrease in total YAP levels in endothelial cells exposed to pulsatile flow is due to degradation via a proteasome-independent mechanism. PMID: 29758328
  6. disruption of TAZ/YAP activity alleviates tumor burden in Lats1/2-deficient mice and inhibits human malignant peripheral nerve sheath tumors cell proliferation PMID: 29438698
  7. Molecular mechanisms of YAP protein in the lung physiological conditions and lung diseases.[review] PMID: 30385178
  8. Report that YAP is subject to non-proteolytic, K63-linked polyubiquitination by the SCF(SKP2) E3 ligase complex (SKP2), which is reversed by the deubiquitinase OTUD1. The non-proteolytic ubiquitination of YAP enhances its interaction with its nuclear binding partner TEAD, thereby inducing YAP's nuclear localization, transcriptional activity, and growth-promoting function. PMID: 29891922
  9. Dual governing of YAP and COX-2 may lead to the discovery of promising therapeutic strategies for HCC patients. PMID: 29505957
  10. YAP messenger RNA (mRNA) and protein expression levels were less in preeclamptic placentas. Yes-associated protein enhanced cell invasion, reduced the cellular apoptotic response, and had no effect on proliferation. PMID: 29303055
  11. Study indicated that lncRNAATB functions as a ceRNA to promote MM proliferation and invasion by enhancing Yes associated protein 1 expression by competitively sponging microRNA miR5905p. PMID: 29956757
  12. O-GlcNAcylation of YAP was required for high-glucose-induced liver tumorigenesis. PMID: 28474680
  13. These results unveil a novel mechanism of YAP activation in cancer and open the possibility to target GR to prevent cancer stem cells self-renewal and chemoresistance. PMID: 28102225
  14. High YAP1 expression is associated with the pathogenesis of gastric cancer. PMID: 30066917
  15. YAP1 as a fluid mechanosensor that functions to regulate genes that promote metastasis. PMID: 28098159
  16. These observations revealed the importance of YAP in promoting TKI-resistance and combined YAP inhibition can be a potential therapy delaying the occurrence of TKI-resistance in lung adenocarcinoma. PMID: 29321482
  17. High Yap expression is associated with resistance to EGFR inhibitors in colorectal cancer. PMID: 30106444
  18. High YAP1 expression is associated with malignant melanoma. PMID: 30106445
  19. Data (including data from studies in knockout mice) suggest that KIBRA plays important role in regulating HPO activity, YAP signaling, and actin cytoskeletal dynamics in podocytes; expression of KIBRA and YAP plus phosphorylation of YAP are up-regulated in glomeruli of patients with focal segmental glomerulosclerosis. (KIBRA = kidney/brain protein-KIBRA; HPO = hepatopoietin protein; YAP = Yes associated protein-1) PMID: 28982981
  20. YAP/TAZ mechanotransduction integrates with cell-cell communication pathways for fine-grained orchestration of stem cell decisions. PMID: 28513598
  21. YAP1 regulates the SOX2 expression in urothelial carcinoma of the bladder.COX2 and YAP1 signaling pathways are connected with each other to induce SOX2 expression, cancer stem cell enrichment, and acquired resistance to chemotherapy in urothelial carcinoma of the bladder. PMID: 29180467
  22. our study showed for the first time that MLK7-AS1 interacted with miR-375 to promote proliferation, metastasis, and EMT process in ovarian cancer cells through upregulating YAP1. PMID: 30249278
  23. Loss of DLG5 expression promoted breast cancer progression by inactivating the Hippo signaling pathway and increasing nuclear YAP. PMID: 28169360
  24. YAP enhances gastric cancer cell proliferation. PMID: 30021363
  25. miR-205 targets YAP1 and inhibits proliferation and invasion of thyroid cancer cells. PMID: 29845281
  26. FAK controls the nuclear translocation and activation of YAP in response to mechanical activation and submit that the YAP-dependent process of durotaxis requires a cell with an asymmetric distribution of active and inactive FAK molecules. PMID: 29070586
  27. the tumor promoting role of YAP is involved in SHP2 which functions as a tumor promoter in vitro but as a tumor suppressor in vivo PMID: 29699904
  28. The combined treatment significantly sensitized the A549/DDP cells to DDPinduced growth inhibition by reducing YAP promoter activity. PMID: 29901163
  29. These results reveal a novel positive feedback loop involving CD44S and YAP1, in which CD44S functions as both an upstream regulator and a downstream effector of YAP1 in hepatocellular carcinoma. PMID: 29649630
  30. hypoxic stress in the hepatocellular carcinoma (HCC)cells promoted YAP binding to HIF-1a in the nucleus and sustained HIF-1a protein stability to bind to PKM2 gene and directly activates PKM2 transcription to accelerate glycolysis PMID: 30180863
  31. PTEN lipid phosphatase inactivation abolished the MOB1-LATS1/2 interaction, decreased YAP phosphorylation and finally promoted YAP nuclear translocation, which enhanced the synergistic effect of YAP-TEAD, thus inducing cell proliferation and migration. PMID: 30134988
  32. Up-regulation of COPB2 inhibited cell apoptosis and promoted cell growth and tumorigenesis through up-regulating YAP1 expression in lung adenocarcinoma. PMID: 29674272
  33. In the present review, we focus on the functions of YAP/TAZ in cancer, discuss their potential as new therapeutic target for tumor treatment, and provide valuable suggestions for further study in this field. PMID: 29749524
  34. HuR acts as a tumor promoter by enhancing YAP expression in osteosarcoma cells. PMID: 29597092
  35. These results indicate a negative link between miR-622 and YAP1 and further confirm that YAP1 is a direct target of miR-622, suggesting that miR-622 could be a new important therapeutic strategy for gliomas treatment. PMID: 28796324
  36. YAP1 and LATS1 can be considered as new prognostic factors in clear cell renal cell carcinoma. PMID: 29850494
  37. Yap1 expression in aggressive thyroid cancer. PMID: 28120182
  38. These results suggested that silibinin induced glioblastoma cell apoptosis concomitant with autophagy which might be due to simultaneous inhibition of mTOR and YAP and silibinin induced autophagy exerted a protective role against cell apoptosis in both A172 and SR cells. PMID: 29780826
  39. these observations suggest that Zyxin promotes colon cancer tumorigenesis in a mitotic-phosphorylation-dependent manner and through CDK8-mediated YAP activation. PMID: 29967145
  40. we discover that Verteporfin (VP) inhibits YAP-induced bladder cancer cell growth and invasion via repressing the target genes' expression of Hippo signaling pathway. PMID: 29725256
  41. Myeloid Zinc Finger 1 and GA Binding Protein Co-Operate with Sox2 in Regulating the Expression of Yes-Associated Protein 1 in Cancer Cells PMID: 28905448
  42. lncBRM and YAP1 signalling may serve as biomarkers for diagnosis and potential drug targets for hepatocellular carcinoma. PMID: 27905400
  43. lncARSR interacts with Yes-associated protein (YAP) to block its phosphorylation by LATS1, facilitating YAP nuclear translocation. PMID: 27886176
  44. YAP contributes to glioma cell migration and invasion by regulating N-cadherin and Twist, as well as cytoskeletal reorganization. PMID: 29306996
  45. LIFR attenuates tumor metastasis by suppressing YAP expression, suggesting that LIFR may serve as a potential target for clear cell renal cell carcinoma treatment. PMID: 29902078
  46. Serine/threonine-protein kinase proteins, also known as P21-activated kinase (PAK), and the mechanosensitive factor, Yes-associated protein 1 (YAP-1) are core mediators of pro-fibrotic integrin beta-1 signaling. PMID: 27535340
  47. The gene transcription and protein expression of YAP may be involved in the development of prostate cancer and may be considered a potential target for the treatment of such cancers. PMID: 29286134
  48. Upregulated miR-200a enhances treatment resistance via antagonizing TP53INP1 and YAP1 in breast cancer. PMID: 29329575
  49. Bioinformatics analysis and luciferase reporter assays indicated that miR625 targeted the 3'untranslated region of Yesassociated protein 1 (YAP1). PMID: 29257207
  50. functional evaluation of a HTM cell monolayer using a permeability assay demonstrated that the inhibition of YAP and TAZ attenuated the DEX-induced impairment of permeability. These findings suggest that YAP and TAZ play pivotal roles in the DEX-induced cytoskeletal changes of HTM cells, and reveal novel potential mechanisms for the development and progression of glaucoma PMID: 29115373
  51. the role of YAP in deciding cell competitions depends on metabolic factors and the status of neighboring cells PMID: 27324860
  52. we found that nuclear translocation of yes-associated protein (YAP) was regulated by cisplatin-induced autophagy, and we identified YAP as a survival input that promoted survival in cisplatin-treated breast cancer cells PMID: 29039616
  53. EphA2-mediates glutaminolysis through YAP/TAZ activation in HER2-positive breast cancer and may serve as potential therapeutic targets in patients. PMID: 29208682
  54. data reveal that YAP promotes metastasis of breast cancer cells by repressing GDF15 transcription and present a novel molecular mechanism underlying the pro-metastasis function of YAP oncoprotein, with the implication of a therapeutic avenue for breast cancer treatment. PMID: 29499325
  55. we provide evidence that S100A7 also inhibits YAP expression and activity through p65/NFkappaB-mediated repression of DeltaNp63, and S100A7 represses drug-induced apoptosis via inhibition of YAP. PMID: 28923839
  56. Findings identify that YAP promotes human glioma growth through enhancing Wnt/beta-catenin signaling. PMID: 28962630
  57. Here, the cross-talk between these pathways and the impact on eRMS tumorigenesis is reported. Using human eRMS cells grown as three-dimensional (3D) rhabdospheres, which enriches in stem cells, it was found that Notch signaling transcriptionally upregulates YAP1 gene expression and YAP activity. PMID: 28923841
  58. Overexpression of Yes-associated protein contributes to hepatocellular carcinoma formation, and its overexpression is associated with vascular invasion, low cellular differentiation tumours larger than 5 cm, and TNM tumour stage III + IV. [meta-analysis] PMID: 28345185
  59. we identified YAP-driven AXL overexpression as a mechanism of resistance to EGFR TKIs in lung cancer cells. PMID: 29136529
  60. Results show that YAP was localized to the nucleus in human cholangiocarcinoma (CCA) specimens and cell lines and that PDGF inhibition decreases YAP nuclear localization and transcriptional activity. Also, tyrosine phosphorylation of YAP by Src family kinases seems to determine subcellular localization in CCA cells. PMID: 28661054
  61. These results indicate that Merlin/YAP/cMyc/mTOR signaling axis promotes human cholangiocarcinoma (CCA) cell proliferation by overriding contact inhibition. We propose that overriding cMycmediated contact inhibition is implicated in the development of CCA. PMID: 28849072
  62. oroxylin A relieved alcoholic liver injury possibly by inhibiting the senescence of hepatocyte, which was dependent on its activation of YAP in hepatocytes. PMID: 29318697
  63. Knockdown of YAP inhibits the proliferation activity and induces apoptosis of human periodontal ligament stem cells with the involvement of Hippo pathway and has a crosstalk between Erk and Bcl-2 signaling pathways. PMID: 29104479
  64. we speculate that YAP/TAZ in dependent of FOS may promote DNMT1 and subsequently mediate DNMT1-G9A complex involving serine metabolism and the methylation of DNA and histone. We hope that our study will stimulate further studies and a new targeted therapy and early medical intervention for YAP/TAZ could be a useful option for breast cancer cases complicated with LKB1 deficiency. PMID: 28931725
  65. Down-regulation of YAP inhibits growth of malignant pleural mesothelioma cells. PMID: 28470935
  66. YAP1 interacted with TEAD1, exerted their transcriptional control of the functional target, glucose transporter 1 (Glut1). PMID: 28892790
  67. Depletion of either YES-associated protein (YAP) or transcriptional coactivator with PDZ-motif (TAZ) sensitised cancer cell lines to MLN8237, resulting in apoptosis and reduction in aurora-A. PMID: 29848699
  68. YAP1 overexpression reversed the inhibitory effects of miR-345 on MHCC-97H migration and invasion, while YAP1 knockdown reduced the promoting effects of miR-345 knockdown on the metastatic behavior of Hep3B cells. PMID: 28677785
  69. E6 association with cellular PDZ proteins promotes the nuclear localization of YAP1. PMID: 29346075
  70. Findings suggest that YAP activation in GCMSCs plays an important role in promoting gastric cancer progression. PMID: 28848999
  71. the expression level of YAP was significantly increased in LSCC and associated with the malignant status of LSCC. Therefore, YAP may represent a novel biomarker for predicting the prognosis of patients with LSCC. PMID: 28791393
  72. No significant correlations emerged for YAP or AREG expression and VIII CN schwannoma volume. PMID: 28430338
  73. MEKK3 KO reduced both EMT and cell migration, the size of 3D colonies and the percentage of CD44(+)/CD24(+)/EpCAM(+) CSC, promoter recruitment of YAP/TAZ and the expression of their target genes. PMID: 29599309
  74. we also found that FGF8 increased the expression of YAP1 and knockdown of YAP1 eliminated the upregulation of EGFR and the resistance to EGFR inhibition induced by FGF8. Our study provides evidence that FGF8 plays an important role in the resistance to EGFR inhibition of human hepatocellular carcinoma cells PMID: 28791365
  75. Data show that tumor suppressor adenomatous polyposis coli (APC) loss results in up-regulation of IL-6 signal transducer (IL-6ST/gp130), thereby activating YAP (YY1-associated) protein (YAP) which are simultaneously up-regulated in the majority of colorectal cancer (CRC). PMID: 28130546
  76. Hedgehog-YAP signaling pathway regulates glutaminolysis to control activation of hepatic stellate cells and their transdifferentiation into myofibroblasts. PMID: 29305935
  77. The results of the present study suggested that miR205 inhibited glioma growth and metastasis by directly targeting YAP1. PMID: 28627687
  78. data show an association of YAP-1 expression with worse clinicopathologic features of thyroid tumors that seem to have a specific impact on outcome PMID: 27753655
  79. Our findings strongly suggested that 5-HT and Yap, which acted as a promoter of HCC, might be prognostic predictors for HCC patients. PMID: 28537892
  80. Collectively, these results show that inhibition of YAP inhibits proliferation and induces apoptosis in HL-60 cells. Therefore, a novel treatment regime involving genetic or pharmacological inhibition of YAP could be established for acute promyelocytic leukemia. PMID: 28824329
  81. Results show that YAP and TAZ transcription are regulated by Cbx7 inhibiting glioblasoma cell migration. PMID: 27291091
  82. Data suggest that overexpression of Yes associated protein 1 (YAP1) may occur as a part of tumorigenesis of pancreatic ductal adenocarcinoma (PDAC). PMID: 28697132
  83. A statistically significant increase in YAP nuclear localization has been found in 100% of pediatric hepatocellular carcinoma patients. PMID: 27605415
  84. Mechanistically, Dnd1 could bind to 3'-UTR of LATS2, the key kinase of Hippo pathway, thus elevating LATS2 mRNA stability and its expression, subsequently leading to phosphorylation of YAP and its cytoplasmic retention. PMID: 28593479
  85. YAP (Yes-associated protein) expression negatively regulates TIA1 (Rox8 ortholog) expression and cell invasion in human cancer cells. PMID: 28174264
  86. Proton-sensing GPR4 signaling mediated the proton-induced inhibitory effects on the osteogenesis of BMSCs. YAP was the downstream effector of GPR4 signaling. Extracellular pH modulates the osteogenic responses of BMSCs by regulating the proton-sensing GPR4-YAP pathway. PMID: 27256071
  87. p110alpha subunit of PI3K and PKD mediate YAP activation in response to insulin and neurotensin in pancreatic cancer cells. Inhibitors of PI3K or PKD disrupt crosstalk between insulin receptor and GPCR signaling systems by blocking YAP/TEAD-regulated gene expression in pancreatic cancer cells PMID: 28360038
  88. Subnuclear localization of YAP provides evidence for its involvement in the altered proliferation behavior during alcohol-induced oral carcinogenesis. PMID: 29104085
  89. Study suggestes that Rab11a serves as an important oncoprotein and a regulator of YAP in human non-small cell lung cancer. PMID: 28468127
  90. Study demonstrates for the first time that S100A7 not only functions as a facilitator of adenous-squamous carcinoma phenotypic transition in lung cancer cells but also that its expression is differentially regulated by the Hippo-YAP pathway. PMID: 28177901
  91. Deregulation of LATS1 and YAP1 expression is associated with clear cell renal cell carcinoma progression and poor patient survival. PMID: 28504812
  92. YAP1 activation was more commonly found in CCAs than in pure HCCs. However, a differing pattern of YAP1 expression between cHC-CCAs and CK19(+) HCCs and the poor prognosis of YAP1 positive hepatic carcinomas suggests that YAP1 may have a preferential role in aggressive tumor behavior, rather than in the determination of cellular lineage in hepatic carcinomas PMID: 28645247
  93. Results indicate Yes associated protein 1 (YAP) as a regulator of neuroblastoma proliferation, tumorigenesis, and a potential therapeutic target for cisplatin-resistant neuroblastoma. PMID: 28415761
  94. thiazolidinediones (PPARgamma agonists) promote differentiation of cancer stem cells by restraining YAP transcriptional activity PMID: 27528232
  95. These findings demonstrate that the UCA1/miR-18a/YAP1 axis plays an important role in regulating the sensitivity of breast cancer cells to trastuzumab, which has implications for the development of novel approaches to improving breast cancer responses to targeted therapy. PMID: 29408336
  96. YAP promotes the expression of ARHGAP29 to suppress the RhoA-LIMK-cofilin pathway, destabilizing F-actin. PMID: 28538170
  97. The close relationship between YAP/TAZ and Ki-67. PMID: 28512636
  98. Results found YAP1 overexpressed in lung cancer side population cells. YAP1 regulates ABCG2 at the transcriptional level through binding to the promoter of ABCG2. The study adds a new function for YAP1 that may be relevant to drug resistance and cancer therapy through regulation of ABCG2 and side population cell formation in lung cancer. PMID: 27911857
  99. YAP1 overexpression is a marker of poor prognosis for pediatric patients with adrenocortical tumors PMID: 27705928
  100. YAP/ TAZ pathways contribute to the proliferation/quiescence switch during colon cancer 5FU treatment according to the concerted regulation of Cyclin E1 and CREB PMID: 27527859

Show More

Hide All

Involvement in disease Coloboma, ocular, with or without hearing impairment, cleft lip/palate, and/or mental retardation (COB1)
Subcellular Location Cytoplasm, Nucleus
Protein Families YAP1 family
Tissue Specificity Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).
Database Links

HGNC: 16262

OMIM: 120433

KEGG: hsa:10413

STRING: 9606.ENSP00000282441

UniGene: Hs.503692

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1