Recombinant Human Transcriptional coactivator YAP1(YAP1)

In Stock
Code CSB-YP026244HU
Size US$2010Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names YAP1
Uniprot No. P46937
Research Area Cancer
Alternative Names Protein yorkie homologYes-associated protein YAP65 homolog
Species Homo sapiens (Human)
Source Yeast
Expression Region 1-504aa
Target Protein Sequence MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 56.5kDa
Protein Length Full Length
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA Please contact us to get it.
Still Have Questions? Leave a Message or Start an on-line Chat

Q&A and Customer Reviews

 Q&A
Q:

For item CSB-YP026244HU, would you please verify the buffer? We need a product without Imidazole.

A:
Thanks for your inquiry.
When separating and purifying the protein, we use imidazole for elution. We can remove the imidazole as much as possible by dialysis, but we can't guarantee that there is no residue at all.
If you care about imidazole, please remark this request when sending the PO and we will try to remove the imidazole by dialysis as much as possible.
(We generally use a concentration of 200 mM - 500 mM imidazole to elute, which should be removed after dialysis.)
Please do not hesitate to contact us if you have further questions. Nice day.
Q:

I am interested in this protein but I'm wondering if it’s possible to obtain the elute in 20% glycerol instead of 50%? If this is possible, can you please tell me the size and cost?

A:
Thanks for your inquiry. CSB-YP026244HU Recombinant Human Yorkie homolog(YAP1)
The delivery form is liquid. The storage buffer is 20 mM Tris-HCl, 0.5M NaCl, pH 8.0, 20% glycerole.
We could satisfy the your requirement for the glycerole content. Any more questions, feel free to contact us.
 Customer Reviews

Target Data

Function Transcriptional regulator which can act both as a coactivator and a corepressor and is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis
Involvement in disease Coloboma, ocular, with or without hearing impairment, cleft lip/palate, and/or mental retardation (COB1)
Subcellular Location Cytoplasm, Nucleus
Protein Families YAP1 family
Tissue Specificity Increased expression seen in some liver and prostate cancers. Isoforms lacking the transactivation domain found in striatal neurons of patients with Huntington disease (at protein level).
Database Links

HGNC: 16262

OMIM: 120433

KEGG: hsa:10413

STRING: 9606.ENSP00000282441

UniGene: Hs.503692

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.