Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
65 kDa Yes associated protein; 65 kDa Yes-associated protein; COB1; YAp 1; YAP 65; YAP; YAP-1; YAP1; YAP1_HUMAN; YAP2; YAP65; yes -associated protein delta; Yes associated protein 1 65kDa; Yes associated protein 1; Yes associated protein 2; yes associated protein beta; YKI; Yorkie homolog
Species
Homo sapiens (Human)
Expression Region
1-504aa
Target Protein Sequence
MDPGQQPPPQPAPQGQGQPPSQPPQGQGPPSGPGQPAPAATQAAPQAPPAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYSVPRTPDDFLNSVDEMDTGDTINQSTLPSQQNRFPDYLEAIPGTNVDLGTLEGDGMNIEGEELMPSLQEALSSDILNDMESVLAATKLDKESFLTWL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The fusion tag N-terminal 6xHis-B2M tag gene was added to the gene sequence corresponding to the E.coli of the human YAP1 protein to form the recombinant DNA. The recombinant DNA was cloned into the expression vector and then transformed into the E.coli for expression. Following purification, the product is the recombinant human YAP1 protein carrying N-terminal 6xHis-B2M tag. The SDS-PAGE assessed the purity of this recombinant YAP1 protein up to 85%. It had an apparent molecular weight of approximately 78 kDa. This recombinant YAP1 protein may be used in YAP1-mediated cancer research.
YAP1 is a gene encoding a protein named transcriptional coactivator YAP1 (abbreviated YAP1) in human and belongs to YAP1 family. This protein acts as a transcriptional regulator by activating the transcription of genes involved in cell proliferation and suppressing apoptotic genes. It is the critical downstream regulatory target in the Hippo signaling pathway that plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. Reported diseases associated with YAP1 include Coloboma, Ocular, With Or Without Hearing Impairment, Cleft Lip/Palate, And/Or Mental Retardation and Coloboma Of Macula.