Recombinant Human Zinc finger protein 350 (ZNF350)

Code CSB-YP026694HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP026694HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP026694HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP026694HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP026694HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
ZNF350
Uniprot No.
Alternative Names
KRAB zinc finger protein ZFQR; ZBRK1; ZFQR; Zinc finger and BRCA1 interacting protein with a KRAB domain 1; Zinc finger and BRCA1-interacting protein with a KRAB domain 1; Zinc finger protein 350; Zinc finger protein ZBRK1; ZN350_HUMAN; ZNF350
Species
Homo sapiens (Human)
Expression Region
1-532
Target Protein Sequence
MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKL EQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQF LLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPA SQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCE KAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSG LIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLA NRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP
Protein Length
full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Related Products

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Transcriptional repressor. Binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.
Gene References into Functions
  1. Results indicate ZNF350 as an important gene mammary oncogenesis. PMID: 29653063
  2. Results indicated that SNP rs2278414 at ZNF350 may in fl uence an individual's susceptibility to age-related cataract (ARC) by affecting the binding af fi nity of miR-21-3p and miR-150-5p and regulating expression levels of the mRNAs, resulting in different levels of cellular DNA breaks, thus contributing to ARC. PMID: 27586871
  3. villin directly interacts with a transcriptional corepressor and ligand of the Slug promoter, ZBRK1. PMID: 26658611
  4. ZBRK1 suppresses renal cancer progression perhaps by regulating VHL expression through formation of a complex with VHL and p300 in renal cancer PMID: 25749518
  5. MAGE proteins bind to KAP1, a gene repressor and ubiquitin E3 ligase which also binds KRAB domain containing zinc finger transcription factors (KZNFs), and MAGE expression may affect KZNF mediated gene regulation. PMID: 25107531
  6. The secondary structure of the ZBRK1-DNA complex is found to be significantly altered from the standard B-DNA conformation. PMID: 24924633
  7. results indicate that a loss of ZBRK1 contributes to the increased expression of KAP1, potentiating its role to enhance metastasis and invasion PMID: 23991171
  8. promoter assays in two breast cancer cell lines identified two haplotypes (H11 and H12) stimulating significantly the expression of ZNF350 transcript compared with the common haplotype H8 PMID: 23151675
  9. ZBRK1 negatively regulates the HIV-1 LTR PMID: 22975076
  10. high levels of gene activity in the genomic environment and the pre-deposition of repressive histone marks within a gene increase its susceptibility to KRAB/KAP1-mediated repression PMID: 21791101
  11. KRAB-containing zinc-finger transcriptional regulator, ZBRK1, an interaction partner of the SCA2 gene product ataxin-2. PMID: 20926453
  12. RB.E2F1 complex plays a critical role in ZBRK1 transcriptional repression, and loss of this repression may contribute to cellular sensitivity of DNA damage, ultimately leading to carcinogenesis. PMID: 20713352
  13. Data found that HMGA2, along with a dozen of other genes, was co-repressed by ZBRK1, BRCA1, and CtIP. PMID: 20007691
  14. KRAB/KAP1 recruitment induces long-range repression through the spread of heterochromatin. PMID: 20221260
  15. Our findings suggest that ZBRK1 acts to inhibit metastasis of cervical carcinoma, perhaps by modulating MMP9 expression. PMID: 19996286
  16. ZBRK1 mutation found in BRCA1 and BRCA2 mutation negative probands with breast or ovarian cancer. PMID: 12872252
  17. ZBRK1 is a novel target for DNA damage-induced degradation PMID: 14517299
  18. ZBRK1 zinc fingers have dual roles in sequence-specific DNA-binding and BRCA1-dependent transcriptional repression PMID: 14660588
  19. the CTRD is a novel protein interaction surface responsible for directing homotypic and heterotypic interactions necessary for ZBRK1-directed transcriptional repression PMID: 15496401
  20. interacts with BBLF2/3 to provide a tethering point on oriLyt for the EBV replication complex PMID: 15596820
  21. KRAB-induced transcriptional repression is robust and active over a variety of genomic contexts that include at least the wide range of sites targeted by lentiviral integration PMID: 16997916
  22. Genetic variants and haplotypes of the ZBRK1 gene is associated with breast and ovarian cancer PMID: 17764113
  23. KRAB/KAP1 regulation is fully functional within the context of episomal DNA PMID: 19279087
  24. BRCA1 and ZNF350 may jointly contribute to individuals' susceptibility of breast cancer in Chinese women. PMID: 19484476

Show More

Hide All

Subcellular Location
Nucleus. Nucleus matrix. Note=Associated with the nuclear matrix.
Protein Families
Krueppel C2H2-type zinc-finger protein family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 16656

OMIM: 605422

KEGG: hsa:59348

STRING: 9606.ENSP00000243644

UniGene: Hs.407694

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1