Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-EP008854HU1d1 |
| Product Type | Recombinant Protein |
| Size | US$2466 |
| Uniprot No. | P21462 |
| Relevance | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system |
| Image |
|
| Storage Buffer | Tris-based buffer,50% glycerol |
| Species | Homo sapiens (Human) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Sequence | QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK |
| Research Area | Immunology |
| Source | E.coli |
| Gene Names | FPR1 |
| Protein Names | N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor |
| Expression Region | 306-350aa |
| Tag Info | N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged |
| Mol. Weight | 34.9 kDa |
| Protein Description | Partial |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
| Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors |
| Subcellular Location | Cell membrane, Multi-pass membrane protein |
| Protein Families | G-protein coupled receptor 1 family |
| Tissue Specificity | Neutrophils. |
| Database Links |
HGNC: 3826 OMIM: 136537 KEGG: hsa:2357 STRING: 9606.ENSP00000302707 UniGene: Hs.753 |
| Pathway | Rap1 signaling pathway |
FPR1 Antibodies for Homo sapiens (Human)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA008399 | FPR1 Antibody | Human | WB,IHC,IF,ELISA |
| CSB-PA008400 | FPR1 Antibody | Human | WB,IF,ELISA |
| CSB-PA07129B0Rb | FPR1 Antibody, HRP conjugated | Human | ELISA |
| CSB-PA07129D0Rb | FPR1 Antibody, Biotin conjugated | Human | ELISA |
| CSB-PA07129C0Rb | FPR1 Antibody, FITC conjugated | Human | ELISA |
FPR1 Antibodies for Human
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA07129A0Rb | FPR1 Antibody | Human | ELISA, WB, IHC, IF |
FPR1 Proteins for Homo sapiens (Human)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF008854HU | Recombinant Human fMet-Leu-Phe receptor(FPR1) | in vitro E.coli expression system |
| CSB-YP008854HU1 CSB-EP008854HU1 CSB-BP008854HU1 CSB-MP008854HU1 |
Recombinant Human fMet-Leu-Phe receptor(FPR1),partial | Yeast E.coli Baculovirus Mammalian cell |
Recombinant Human Interferon-induced helicase C domain-containing protein 1(IFIH1),partial
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Indoleamine 2,3-dioxygenase 1(IDO1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Replication factor C subunit 1(RFC1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Aldehyde dehydrogenase family 1 member A3(ALDH1A3)
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Mouse Sulfotransferase 1A1(Sult1a1)
Express system: E.coli
Species: Mus musculus (Mouse)
Wait!
Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now to get your $50 coupon for protein expression service!
We don't deal in spam.
