Recombinant Human fMet-Leu-Phe receptor (FPR1), partial

In Stock
Code CSB-EP008854HU1d1
Abbreviation Recombinant Human FPR1 protein, partial
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008854HU1d1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008854HU1d1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
FPR1; fMet-Leu-Phe receptor; fMLP receptor; N-formyl peptide receptor; FPR; N-formylpeptide chemoattractant receptor
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
306-350aa
Target Protein Sequence
QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 306-350 constitute the expression domain of recombinant Human FPR1. The expected molecular weight for the FPR1 protein is calculated to be 34.9 kDa. Expression of this FPR1 protein is conducted in e.coli. The FPR1 gene fragment has been modified by fusing the N-terminal 10xHis-GST tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant FPR1 protein during the following stages.

The human fMet-Leu-Phe receptor (FPR1) is a GPCR primarily expressed on immune cells such as neutrophils and macrophages. FPR1 is crucial in mediating chemotaxis, phagocytosis, and inflammatory responses. It recognizes N-formylated peptides, which are often released by bacteria during infection. Upon ligand binding, FPR1 activates downstream signaling cascades, leading to cytoskeletal rearrangements, immune cell recruitment, and antimicrobial activities. FPR1's involvement in immune responses makes it a potential target for therapeutic interventions in infectious diseases and inflammatory disorders. Understanding its function provides insights into the regulation of immune cell behavior and offers avenues for developing novel immunomodulatory strategies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. Receptor for TAFA4, mediates its effects on chemoattracting macrophages, promoting phagocytosis and increasing ROS release.
Gene References into Functions
  1. Results show high expression of FPR1 in triple-negative breast cancer (TNBC) and in lymph node metastasis. This expression level was positively correlated with that of AnxA1 in primary tumors. The autocrine activation of FPR1 by AnxA1 might be a pivotal target for TNBC. PMID: 29932988
  2. FPR1 mRNA levels in whole blood can predict the presence of lung cancer. Using this as a reflex test for positive lung cancer screening computed tomography scans has the potential to increase the positive predictive value. PMID: 29313979
  3. To develop enzyme-resistant analogues, we applied here the Retro-Inverso (RI) approach, whereby the topology of the side chains is maintained by inverting the sequence of the peptide and the chirality of all residues. Molecular dynamics suggests that peptide RI-3 adopts the turn structure typical of uPAR-FPR1 antagonists PMID: 28465589
  4. Authors found that the co-expression of uPAR and FPR1 confers to A375 and M14 melanoma cells a clear-cut capability to move towards chemotactic gradients, to cross extracellular matrix and endothelial monolayers. FPR1 activity is required, as cell migration and invasion were abrogated by receptor desensitization. PMID: 29216889
  5. Taken together, our results suggest that intracellular FPR in naive CD4 T cells and surface FPRs in activated CD4 T cells might regulate immune responses by regulating CD4 T cell activity. PMID: 29427663
  6. the FPR1 downstream signaling pathways were competitively inhibited by HCH6-1. Furthermore, HCH6-1 prevented pulmonary neutrophil infiltration and edema along with alveolar damage in LPS-induced ALI in mice. Our findings suggest that HCH6-1, a FPR1 antagonist, may have potential as a new therapeutic agent for treating FPR1-involved inflammatory lung diseases PMID: 28232203
  7. The data demonstrate that FPR1 is involved in neuroblastoma development and could represent a therapy option for the treatment of neuroblastoma. PMID: 27432059
  8. FAM3D plays a role in gastrointestinal homeostasis and inflammation through its receptors FPR1 and FPR2. PMID: 26966188
  9. Formylated MHC class Ib binding peptides activate both human and mouse neutrophils primarily through FPR1. PMID: 27907124
  10. The inhibitory function of oxidant sensing by TRPM2 requires the oxidation of Cys549, which then induces TRMP2 binding to formyl peptide receptor 1 (FPR1) and subsequent FPR1 internalization and signaling inhibition PMID: 27569419
  11. FPR1 expression is significantly upregulated in human masticatory mucosa during wound healing PMID: 28005267
  12. FAM19A4 is a novel ligand of formyl peptide receptor 1. PMID: 25109685
  13. The authors describe here the activation of isolated human blood neutrophils by TcdB and, moreover, by toxin fragments generated by limited proteolytical digestion via the FPR1 receptor. PMID: 25529763
  14. these results highlight the importance of FPR1 in chemotherapy-induced anticancer immune responses. PMID: 26516201
  15. Data suggest that formyl peptide receptor 1 (FPR1) stimulation may represent a novel therapeutic approach to counteract tumor angiogenesis. PMID: 25263443
  16. a pepducin designed to target FPR1 was found to hijack FPR2 and potently inhibit neutrophil functions PMID: 26071379
  17. the co-upregulated expression of mast cell chymase and ANXA1-FPR1 system in ectopic endometrium suggests their involvement in the development of endometriotic lesions. PMID: 25201101
  18. FPR1 rs78488639 interacted with CFH rs800292, HTRA1 rs11200638, and smoking, enhancing risk to exudative age-related macular degeneration and polypoidal choroidal vasculopathy . PMID: 25277308
  19. These results demonstrate that a necroptosis pathway, likely mediated by annexin 1 acting through the FPR1 receptor, contributes to Stevens-Johnson syndrome (SJS) and toxic epidermal necrolysis. PMID: 25031270
  20. A low FPR1/beta1 integrin co-localization was observed. PMID: 24466048
  21. cross-desensitization of CCR1 by FPR1 was associated with CCR1 phosphorylation and moderate reduction of CCR1 cell-surface expression. In contrast, CCR2 was not phosphorylated or internalized after FPR1 activation. PMID: 24778447
  22. FPR1 expression may be used as a novel indicator to predict outcome in gastric cancer patients after gastrectomy. PMID: 24778024
  23. Identification of C-terminal phosphorylation sites of N-formyl peptide receptor-1 (FPR1) in human blood neutrophils. PMID: 23873933
  24. The active F2Pal10 pepducin also triggered a response in cells expressing a mutated FPR2 with the third intracellular loop identical to that of FPR1. PMID: 23562731
  25. Our findings reveal that FPR and FPRL1 are overexpressed in primary melanoma and correlate with aggressive tumor characteristics PMID: 23147350
  26. UPAR, whose expression is regulated by uPA, can, in turn, regulate uPA expression through a mechanism involving its functional interaction with integrins and fMLF-Rs. PMID: 23238745
  27. haplotypic variation in FPR1, especially the SNP p.V101L, alters the receptor's response to cyclosporins PMID: 23373827
  28. The expression of the formyl peptide receptor 1 (FPR1) gene in primary human macrophages is regulated by cytokines and bacterial ligands. PMID: 23185575
  29. FPR1 is functionally expressed on human lens epithelial cells. PMID: 23012360
  30. physiological shear forces alter neutrophil activation via FP PMID: 22768936
  31. analysis of pyrazoles as novel FPR1 antagonists PMID: 22094028
  32. The expression of FPR1 in myeloid cells is developmentally regulated, and the differentiated cells are equipped for immediate response to microbial infections. PMID: 22174875
  33. When normotensive individuals were compared to hypertensives ones, similar FPR1 C32T genotypes and allele frequency distributions were found PMID: 21144844
  34. Enteric commensal bacteria induce extracellular signal-regulated kinase pathway signaling via formyl peptide receptor-dependent redox modulation of dual specific phosphatase 3 PMID: 21921027
  35. Using the homology modeling of the receptors and the ligand docking simulation, here we show that these calpain inhibitors could bind to the putative N-formyl-Met-Leu-Phe (fMLF) binding site on FPR and/or FPRL1. PMID: 22005393
  36. fMLP promotes osteoblast differentiation via the N-formyl peptide receptor 1-mediated signaling pathway in human mesenchymal stem cells from bone marrow PMID: 21372136
  37. This study identifies annexin A1 as part of the anti-inflammatory pattern of apoptotic cells and links the activation of FPRs to established signalling pathways triggering anti-inflammatory responses. PMID: 21254404
  38. This is the first study to evaluate polymorphisms of the FPR1 gene in stomach cancer to find a positive association between these polymorphisms and stomach cancer. PMID: 21216225
  39. These observations suggest a novel signaling role for ANXA1 in mitogen-activated proliferation of breast tumor epithelial cells that is mediated via activation of FPR1 and FPR2. PMID: 20930115
  40. The presence of the C(+) genotype/allele C of FPR301 together with smoking conferred a higher risk for aggressive periodontitis. PMID: 20019777
  41. The expression of FPR is responsible for increased motility of human glioblastoma cells and their formation of highly invasive tumours. PMID: 20197768
  42. A conformational study of human fMLP PMID: 11860029
  43. investigated the direct effect of LXA4 as well as the effect on agonist-induced biological responses using transfected HL-60 cells expressing FPR, FPRL1 or FPRL2 PMID: 12410796
  44. phosphorylation domains differentially regulate arrestin and agonist affinity PMID: 12424254
  45. Critical role of N-terminal N-glycosylation for proper folding of the formyl peptide receptor. PMID: 12565836
  46. Six single nucleotide polymorphisms have been identified including two located in the FPR1 second extracellular loop that are significantly associated with the periodontitis phenotype in African-American patients. PMID: 12595898
  47. Expression of FPRs on transformed or normal fibroblasts indicates that they are able to induce intracellular signaling events leading to fibroblast motility. PMID: 12902510
  48. an annexin 1 peptide can activate FPR, FPRL1, and FPRL2; results indicate that annexin 1 participates in regulating leukocyte emigration into inflamed tissue by activating and desensitizing different receptors of the FPR family. PMID: 15187149
  49. FPR-F110S displayed a delayed and significantly reduced ERK phosphorylation whereas FPR-FSCW nearly lost the ability to phosphorylate ERK PMID: 15195697
  50. FPR and FPRL1, use distinct signaling pathways in activation of human neutrophils PMID: 15625007

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Neutrophils.
Database Links

HGNC: 3826

OMIM: 136537

KEGG: hsa:2357

STRING: 9606.ENSP00000302707

UniGene: Hs.753

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*