Recombinant Human fMet-Leu-Phe receptor(FPR1),partial

In Stock
Code CSB-EP008854HU1d1
Product Type Recombinant Protein
Size
Uniprot No. P21462
Relevance High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors. Binding of fMLP to the receptor stimulates intracellular calcium mobilization and superoxide anion release. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008854HU1d1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP008854HU1d1 could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) FPR1.
Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Research Area Immunology
Source E.coli
Gene Names FPR1
Protein Names N-formyl peptide receptor Short name: FPR N-formylpeptide chemoattractant receptor
Expression Region 306-350aa
Tag Info N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Mol. Weight 34.9 kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function High affinity receptor for N-formyl-methionyl peptides (fMLP), which are powerful neutrophil chemotactic factors
Subcellular Location Cell membrane, Multi-pass membrane protein
Protein Families G-protein coupled receptor 1 family
Tissue Specificity Neutrophils.
Database Links

HGNC: 3826

OMIM: 136537

KEGG: hsa:2357

STRING: 9606.ENSP00000302707

UniGene: Hs.753

Pathway Rap1 signaling pathway

Related Products

FPR1 Antibodies

FPR1 Antibodies for Homo sapiens (Human)

FPR1 Antibodies for Human

FPR1 Proteins

FPR1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.