Purity
Greater than 85% as determined by SDS-PAGE.
Alternative Names
FPR1; fMet-Leu-Phe receptor; fMLP receptor; N-formyl peptide receptor; FPR; N-formylpeptide chemoattractant receptor
Species
Homo sapiens (Human)
Expression Region
306-350aa
Target Protein Sequence
QDFRERLIHALPASLERALTEDSTQTSDTATNSTLPSAEVELQAK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 306-350 constitute the expression domain of recombinant Human FPR1. The expected molecular weight for the FPR1 protein is calculated to be 34.9 kDa. Expression of this FPR1 protein is conducted in e.coli. The FPR1 gene fragment has been modified by fusing the N-terminal 10xHis-GST tag and C-terminal Myc tag, providing convenience in detecting and purifying the recombinant FPR1 protein during the following stages.
The human fMet-Leu-Phe receptor (FPR1) is a GPCR primarily expressed on immune cells such as neutrophils and macrophages. FPR1 is crucial in mediating chemotaxis, phagocytosis, and inflammatory responses. It recognizes N-formylated peptides, which are often released by bacteria during infection. Upon ligand binding, FPR1 activates downstream signaling cascades, leading to cytoskeletal rearrangements, immune cell recruitment, and antimicrobial activities. FPR1's involvement in immune responses makes it a potential target for therapeutic interventions in infectious diseases and inflammatory disorders. Understanding its function provides insights into the regulation of immune cell behavior and offers avenues for developing novel immunomodulatory strategies.
