Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)

In Stock
Code CSB-EP356309HKP
Abbreviation Recombinant Human immunodeficiency virus type 1 group M subtype B rev protein
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
rev
Uniprot No.
Research Area
Others
Species
Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)
Source
E.coli
Expression Region
1-116aa
Target Protein Sequence
MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.0 kDa
Protein Length
Full Length
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Escorts unspliced or incompletely spliced viral pre-mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, that is not present in fully spliced viral mRNAs (early transcripts). This function is essential since most viral proteins are translated from unspliced or partially spliced pre-mRNAs which cannot exit the nucleus by the pathway used by fully processed cellular mRNAs. Rev itself is translated from a fully spliced mRNA that readily exits the nucleus. Rev's nuclear localization signal (NLS) binds directly to KPNB1/Importin beta-1 without previous binding to KPNA1/Importin alpha-1. KPNB1 binds to the GDP bound form of RAN (Ran-GDP) and targets Rev to the nucleus. In the nucleus, the conversion from Ran-GDP to Ran-GTP dissociates Rev from KPNB1 and allows Rev's binding to the RRE in viral pre-mRNAs. Rev multimerization on the RRE via cooperative assembly exposes its nuclear export signal (NES) to the surface. Rev can then form a complex with XPO1/CRM1 and Ran-GTP, leading to nuclear export of the complex. Conversion from Ran-GTP to Ran-GDP mediates dissociation of the Rev/RRE/XPO1/RAN complex, so that Rev can return to the nucleus for a subsequent round of export. Beside KPNB1, also seems to interact with TNPO1/Transportin-1, RANBP5/IPO5 and IPO7/RANBP7 for nuclear import. The nucleoporin-like HRB/RIP is an essential cofactor that probably indirectly interacts with Rev to release HIV RNAs from the perinuclear region to the cytoplasm.
Gene References into Functions
  1. These results suggest a differential interaction between human Crm1 and mouse Crm1 and many lentiviral Rev proteins, which may partially explain the HIV replicative defect in mice. PMID: 29028476
  2. DDX1 binds HIV-1 rev response element to promote virus assembly. PMID: 28379444
  3. Results indicate that the binding between ctDNA and REV peptide is a specific electrostatic interaction governed by oppositely charged molecules. PMID: 27353011
  4. Results support the model that proper folding of Rev is critical in ensuring that the flexible Rev-response element is able to correctly position Rev molecules for specific ribonucleoprotein assembly. PMID: 26620599
  5. Nucleophosmin Interactions with Human Immunodeficiency Virus Rev and Herpes Simplex Virus US11 PMID: 26624888
  6. The DEAG-box of human MOV10 was required for the enhancement of Rev/RRE-dependent nuclear export. PMID: 26379090
  7. Posttranscriptional regulatory Rev protein function and HIV-1 replication in astrocytes proceed unperturbed. PMID: 25188302
  8. Sequestration od DDX1 led to destabilization of the Rev nucleocytoplasmic transport complex and decreased levels of Rev-dependent viral transcripts. PMID: 25496916
  9. RNA-directed remodeling of the HIV-1 protein Rev orchestrates assembly of the Rev-Rev response element complex. PMID: 25486594
  10. This study identifies a cellular protein named RBM14 that is associated with XPO1 (CRM1), a nuclear protein that binds to the HIV-1 Rev protein and mediates nuclear export of incompletely spliced HIV-1 viral RNAs PMID: 25589658
  11. RNA-guided assembly of Rev-Rev response element nuclear export complexes has been described. PMID: 25163983
  12. These results suggest a model wherein HIV-1 Rev-associated nuclear export signals cooperate to regulate the number or quality of CRM1's interactions with viral Rev/RRE ribonucleoprotein complexes in the nucleus. PMID: 25275125
  13. Authors establish that human Staufen-2, a host factor which is up-regulated upon HIV-1 infection, interacts with HIV-1 Rev, thereby promoting its RNA export activity and progeny virus formation. PMID: 24520823
  14. HIV-1 Rev's arginine-rich RNA-binding motif is intrinsically disordered; RRE recognition triggers a crucial coil-to-helix transition employing an induced-fit mechanism PMID: 23972852
  15. The viral Rev response element (RRE) adopts an "A"-like structure in which the two legs constitute two tracks of binding sites for the viral Rev protein and position the two primary known Rev-binding sites ~55 A apart, matching the distance between the two RNA-binding motifs in the Rev dimer. PMID: 24243017
  16. Rather than acting as a simple on-off switch or maintaining a constant level of activity throughout infection, the Rev-Rev response element system can fluctuate, presumably to control replication. PMID: 23926352
  17. Most Rev arginine-rich motif residues tolerated substitutions without strong loss of binding to Rev response element IIB. PMID: 23595810
  18. Results suggest that distinct DDX DEAD-box RNA helicases DDX3 and DDX5 cooperate to modulate the HIV-1 Rev function. PMID: 23608157
  19. HIV-1 Rev protein enhances encapsidation of unspliced and spliced, RRE-containing lentiviral vector RNA PMID: 23133650
  20. PSF and MATR3 are cellular host factors that bind viral RNA and promote Rev activity. PMID: 23158102
  21. Rev oligomerization on the Rev Response Element, thereby recruiting at least two protein activation domains, is required for nuclear export of unspliced and incompletely spliced viral RNA. PMID: 22675540
  22. DDX1 was shown to be an RNA-activated ATPase, wherein Rev-bound RNA was equally effective at stimulating ATPase activity as protein-free RNA. PMID: 22051512
  23. we hypothesize that CRM1 was subject to strong selection event in primate lineage ~80 million years ago that altered sequence of HEAT repeat 9A. Resulting CRM1 sequence is better able to support HIV-1 Rev's function as mediator of viral RNA nuclear export PMID: 22114565
  24. Rev dimerization and oligomerization interfaces to a resolution of 2.5A. PMID: 21941623
  25. HIV-1 Rev protein activates HCV gene expression PMID: 22094166
  26. Rev protein of Human Immunodeficiency Virus type 1 (HIV-1) inhibits nuclear import and mediates nuclear export of the HIV-1 integrase (IN) protein PMID: 21326951
  27. The position of the charges in aminoglycoside antibiotics and the flexibility of their structure, rather than the number of charges, determines whether an aminoglycoside antibiotic will be able to bind with high affinity to TAR RNA. PMID: 21916409
  28. Matrin 3 binds Rev RNA to stabilize HIV-1 transcripts leading to increased cytoplasmic expression. PMID: 21771347
  29. Rev needs MATR3 to promote the cytoplasmic accumulation and translation of unspliced RRE-containing mRNA. PMID: 21771348
  30. MATR3 binds viral RNA and is required for the Rev/RRE mediated nuclear export of unspliced HIV-1 RNAs. PMID: 21771346
  31. The authors show for the first time that the Rev/RRE system can augment RNA encapsidation independent of all cis elements from the 5' UTR (R, U5, PBS, and psi). PMID: 21702950
  32. DDX1 acts as a cellular cofactor by promoting oligomerization of Rev on the Rev response element. PMID: 21763499
  33. The appropriate intracellular localization and dynamics of Rev could regulate Gag assembly and HIV-1 replication. PMID: 21364984
  34. RanBP2 is a host factor that is involved in the nuclear import of HIV-1 PIC (DNA), but is not critical to the nuclear export of the viral mRNAs or nucleo-cytoplasmic shuttling of Rev PMID: 21179483
  35. We demonstrate that HIC selectively interferes with Rev NLS interaction with importin beta and impedes its nuclear import and function, but does not affect Rev nuclear import mediated by transportin. PMID: 21401918
  36. an intrabody based on a llama single-domain antibody targeting the N-terminal alpha-helical multimerization domain of HIV-1 rev prevents viral production PMID: 20406803
  37. These results probably indicate that binding of excess amounts of the human immunodeficiency virus type 1 Rev protein or the NES peptide to the human exportin receptor CRM1 results in cells death. PMID: 20151187
  38. Rev enhanced cytoplasmic levels of the unspliced HIV-1 RNA, mostly 3- to 12-fold, while encapsidation of the RNA and viral infectivity could be stimulated >1,000-fold. PMID: 20427541
  39. The authors conclude that superinfection resistance involves Rev-dependent control of human immunodeficiency virus cDNA integration. PMID: 20147519
  40. Results show that HIV-1 Rev promotes dissociation of the IN-LEDGF/p75 complex. Combination of the viral IN and the cellular LEDGF/p75 is required for proper integration of the viral cDNA into the host chromosomal DNA. PMID: 19855849
  41. Data show that the interaction of HIV-1 Rev with functionally diverse hnRNPs lends support that Rev is a multifunctional protein and may be involved in coupling HIV replication to diverse cellular processes and promoting virus-host cell interactions. PMID: 19808671
  42. HIV-1 Rev transactivator: a beta-subunit directed substrate and effector of protein kinase CK2 PMID: 11827166
  43. Physiologically significant interaction of hNup98 with HIV-1 Rev PMID: 14554087
  44. SF2/ASF and SRp40 activate the ESE (exonic splicing enhancer) which regulates the expression of HIV-1 rev, env, vpu, and nef PMID: 15163745
  45. These findings indicate that DDX1 is a critical cellular co-factor for Rev function, which maintains the proper subcellular distribution of this lentiviral regulatory protein. PMID: 15567440
  46. the effect of Rev on env mRNA transport is low compared with the enhancement of translation of this mRNA PMID: 15777852
  47. All trimerization-defective Rev molecules had profoundly compromised Rev function and a range of localization defects was observed. PMID: 15831964
  48. Yeast-two hybrid screening of a T-cell cDNA library with Rev as bait led to isolation of a novel human cDNA product (16.4.1); results suggest that 16.4.1 may act as a modulator of Rev activity. PMID: 15847701
  49. The backbone cyclic peptide Rev-13 analogue inhibited Rev-induced gene expression in HeLa cells. PMID: 16114892
  50. Data suggest that steady-state subcellular localization is not a primary regulator of Rev activity but may change as a secondary consequence of altered Rev function. PMID: 16368434

Show More

Hide All

Subcellular Location
Host nucleus, host nucleolus. Host cytoplasm.
Protein Families
HIV-1 REV protein family
Database Links

KEGG: vg:155908

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*