Recombinant Human m7GpppN-mRNA hydrolase (DCP2)

In Stock
Code CSB-EP810265HU
Abbreviation Recombinant Human DCP2 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transcription
Alternative Names
DCP2; DCP2 decapping enzyme homolog (S. cerevisiae); DCP2, S. cerevisiae, homolog of; DCP2_HUMAN; decapping enzyme 2, S. cerevisiae, homolog of; decapping enzyme homolog (S. cerevisiae); FLJ33245; hDpc; m7GpppN-mRNA hydrolase; mRNA decapping enzyme 2; mRNA-decapping enzyme 2; Nucleoside diphosphate-linked moiety X motif 20; nudix (nucleoside diphosphate linked moiety X)-type motif 20; Nudix motif 20; NUDT20
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-385aa
Target Protein Sequence
METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQCGIRDFAKAVFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAKSGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIPKDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSRRFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGKKCEKKLHPRKLQDNFETDAVYDLPSSSEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.4kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Producing recombinant human m7GpppN-mRNA hydrolase (DCP2) involves a series of steps beginning with the isolation of the target gene that codes for the 1-385aa of the human DCP2, which is also fused with N-terminal 6xHis-tag for purification purposes. This gene is cloned into an expression vector and transfected into E. coli cells. The E. coli cells express the protein, which is subsequently harvested from the cell lysate. Purification of the protein is commonly achieved using affinity chromatography. Finally, the recombinant DCP2 protein's purity is determined by SDS-PAGE, reaching over 90%.

Human DCP2 is a catalytically active mRNA-decapping enzyme found in specific cytoplasmic structures [1]. It is an RNA-binding protein that selectively binds to a subset of mRNAs containing a stem-loop structure near the 5' cap [2]. DCP2 plays a crucial role in controlling the stability of a subset of human cellular RNAs involved in various functions such as transcription and immune responses [3]. The activation of DCP2 by DCP1 occurs on the EDC4 scaffold and is involved in mRNA degradation by XRN1 in human cells [4]. DCP2 cooperates with MOV10 to de-cap LINE-1 RNA, leading to the degradation of LINE-1 RNA and a reduction in LINE-1 retrotransposition [5].

In humans, the DCP2-DCP1 interaction requires additional proteins like EDC3, ECD4, and the DEAD-box protein DDX6/RCK to form multimeric decapping complexes [6]. DCP2 is regulated at the post-transcriptional level, with miRNAs being an effective way to downregulate its expression [7]. Furthermore, DCP2 preferentially binds to specific mRNAs and has been identified to have specific substrates, such as Rrp41, a core subunit component of the RNA exosome [8].

References:
[1] E. Dijk, N. Cougot, S. Meyer, S. Babajko, E. Wahle, & B. Séraphin, Human dcp2: a catalytically active mrna decapping enzyme located in specific cytoplasmic structures, The Embo Journal, vol. 21, no. 24, p. 6915-6924, 2002. https://doi.org/10.1093/emboj/cdf678
[2] E. Grudzien-Nogalska and M. Kiledjian, New insights into decapping enzymes and selective mrna decay, Wiley Interdisciplinary Reviews - Rna, vol. 8, no. 1, 2016. https://doi.org/10.1002/wrna.1379
[3] Y. Luo, Z. Na, & S. Slavoff, Phage-display selection of a cell-permeable bicyclic peptide as a selective ligand of the human rna decapping enzyme dcp2,, 2020. https://doi.org/10.26434/chemrxiv.12233102.v1
[4] C. Chang, N. Bercovich, B. Loh, S. Jonas, & E. Izaurralde, The activation of the decapping enzyme dcp2 by dcp1 occurs on the edc4 scaffold and involves a conserved loop in dcp1, Nucleic Acids Research, vol. 42, no. 8, p. 5217-5233, 2014. https://doi.org/10.1093/nar/gku129
[5] Q. Liu, D. Yi, J. Ding, Y. Mao, S. Wang, L. Maet al., mov10 recruits dcp2 to decap human line‐1 rna by forming large cytoplasmic granules with phase separation properties, Embo Reports, vol. 24, no. 9, 2023. https://doi.org/10.15252/embr.202256512
[6] F. Tritschler, J. Braun, C. Motz, C. Igreja, G. Haas, V. Truffaultet al., Dcp1 forms asymmetric trimers to assemble into active mrna decapping complexes in metazoa, Proceedings of the National Academy of Sciences, vol. 106, no. 51, p. 21591-21596, 2009. https://doi.org/10.1073/pnas.0909871106
[7] Q. Zhang, Y. Yan, Q. Lv, Y. Li, R. Wang, G. Sunet al., Mir-4293 upregulates lncrna wfdc21p by suppressing mrna-decapping enzyme 2 to promote lung carcinoma proliferation, Cell Death and Disease, vol. 12, no. 8, 2021. https://doi.org/10.1038/s41419-021-04021-y
[8] Y. Li, M. Song, & M. Kiledjian, Transcript-specific decapping and regulated stability by the human dcp2 decapping protein, Molecular and Cellular Biology, vol. 28, no. 3, p. 939-948, 2008. https://doi.org/10.1128/mcb.01727-07

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*