Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2 (blaNDM-1)

In Stock
Code CSB-EP510513KBG
Abbreviation Recombinant Klebsiella pneumoniae blaNDM-1 protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP510513KBG could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae blaNDM-1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP510513KBG could indicate that this peptide derived from E.coli-expressed Klebsiella pneumoniae blaNDM-1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
blaNDM-1
Uniprot No.
Alternative Names
blaNDM-1Metallo-beta-lactamase type 2; EC 3.5.2.6; B2 metallo-beta-lactamase; Beta-lactamase type II; Metallo-beta-lactamase NDM-1; Metallo-beta-lactamase type II; New Delhi metallo-beta-lactamase-1; NDM-1
Species
Klebsiella pneumoniae
Source
E.coli
Expression Region
29-270aa
Target Protein Sequence
GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38.6 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

I am looking for NDM-1 protein from E.coli/ Kpn source for measurement of IC50's of small molecule inhibitors on the catalytic activity of the enzyme, using a chromogenic substrate like Nitrocefin/CENTA or Penicillin G.
Please let me know if Recombinant bacterial metallo beta lactamase NDM-1 can be used for catalytic activity measurements. I am confused about the exact expression region of the protein (164-222aa) and the size of the protein (~13-14KDa? or it is ~7KDa?). Please clarify.

A:
Very nice to receive your inquiry. Kpn should refer to Klebsiella pneumoniae, the Cat No you mentioned corresponds to the region of 29-270aa, but later you mentioned the region of 164-222aa.
We can provide both of the two regions, please check the quotation as follows:
Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1)
CSB-EP510513KBG >> E.coli N-terminal 6xHis-SUMO-tagged
CSB-EP510513KBGa0 >> E.coli N-terminal 6xHis-tagged
Expression Region: 29-270aa; Full length of the mature protein.
Sequence:

GEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQHTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTHAHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAFPKASMIVMSHSAPDSRAAITHTARMADKLR


Recombinant Klebsiella pneumoniae Metallo-beta-lactamase type 2(blaNDM-1),partial
CSB-YP510513KBG1 >> Yeast
CSB-EP510513KBG1 >> E.coli
CSB-BP510513KBG1 >> Baculovirus
CSB-MP510513KBG1 >> Mammalian cell
Expression Region: 164-222aa; Partial.
Tag information: Tag type will be determined during the manufacturing process.
Sequence:

AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG


CSB-EP510513KBG1 Expression Region: 164-222aa; The expected tag is N-terminal 10xHis-tagged and C-terminal Myc-tagged
The Mw of the target protein is around 6kDa, and the Mw of the tag is around 5kDa, so the final Mw of the fusion protein is about 11kDa.
Q:

I am in need of full length NDM-1 from E.coli/Kpn expressed in E.coli, that is enzymatically active.
What is the difference between CSB-EP510513KBG >> E.coli and CSB-EP510513KBGa0 >> E.coli ?
Can you provide references where these proteins are used for in vitro catalytic activity (IC50) measurements (hydrolysis of carbapenems).

A:
Thanks for your inquiry. The difference between CSB-EP510513KBG >> E.coli and CSB-EP510513KBGa0 >> E.coli is the tag, CSB-EP510513KBG: N-terminal 6xHis-SUMO-tagged; CSB-EP510513KBGa0: N-terminal 6xHis-tagged;
We can provide these proteins, but as we haven't tested the activity, so we can't guarantee it's enzymatically active.
Sorry, there isn't any references where these proteins are used for in vitro catalytic activity (IC50) measurements (hydrolysis of carbapenems).

Target Background

Function
Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin.
Subcellular Location
Periplasm.
Protein Families
Metallo-beta-lactamase superfamily, Class-B beta-lactamase family
Database Links

KEGG: ag:CAZ39946

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*