Recombinant Klebsiella pneumoniae Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

In Stock
Code CSB-EP471321KBH
Abbreviation Recombinant Klebsiella pneumoniae arnT protein, partial
MSDS
Size $388
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
4-amino-4-deoxy-L-arabinose lipid A transferase Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase Undecaprenyl phosphate-alpha-L-Ara4N transferase
Species
Klebsiella pneumoniae (strain 342)
Source
E.coli
Expression Region
429-551aa
Target Protein Sequence
RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Klebsiella pneumoniae Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) is expressed in E. coli and includes an N-terminal 6xHis-tag for simplified purification. The product represents a partial protein spanning amino acids 429-551 and achieves greater than 90% purity as determined by SDS-PAGE. This research-use-only protein serves as a reliable tool for laboratory studies requiring high-quality reagents.

The arnT gene in Klebsiella pneumoniae encodes a protein that appears to play a crucial role in bacterial resistance mechanisms. Acting as an arabinosyl transferase, it modifies lipopolysaccharides—key components of the bacterial outer membrane. This modification may influence the bacterium's susceptibility to certain antibiotics, which makes arnT a significant focus in microbial resistance studies and a potentially valuable target for antibacterial research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Biochemical Characterization of ArnT Enzymatic Properties

Researchers can use this recombinant ArnT fragment (429-551aa) to investigate biochemical properties of the C-terminal region of undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase from Klebsiella pneumoniae. The high purity (>90%) likely makes it suitable for kinetic studies, substrate binding assays, and cofactor requirement analysis to understand catalytic mechanisms. The N-terminal His-tag simplifies purification and immobilization for enzyme activity measurements. This partial protein may retain specific functional domains that contribute to overall transferase activity, though further validation would be necessary.

2. Antibody Development and Validation

The purified recombinant ArnT fragment serves as a potentially excellent immunogen for generating polyclonal or monoclonal antibodies specific to Klebsiella pneumoniae ArnT. Researchers can use the His-tagged protein in ELISA-based screening assays to identify and characterize antibody specificity and affinity. These antibodies would become valuable research tools for studying ArnT expression, localization, and regulation in bacterial cells. High purity should ensure minimal cross-reactivity with other bacterial proteins during antibody development.

3. Protein-Protein Interaction Studies

Scientists may use the His-tagged ArnT fragment in pull-down assays to identify potential protein partners involved in lipopolysaccharide modification pathways in Klebsiella pneumoniae. The tag allows immobilization on nickel-affinity matrices for capturing interacting proteins from bacterial lysates. This approach could reveal regulatory proteins or other enzymes that form complexes with ArnT during arabinose transfer reactions. Such studies might advance understanding of molecular networks controlling bacterial cell wall biosynthesis.

4. Structural and Biophysical Analysis

This recombinant protein fragment provides material for structural biology studies including X-ray crystallography, NMR spectroscopy, or cryo-electron microscopy to elucidate the three-dimensional structure of the ArnT C-terminal region. High purity is essential for obtaining quality crystals or NMR spectra. Biophysical techniques such as dynamic light scattering, circular dichroism, and thermal stability assays can characterize protein folding, stability, and conformational changes. These studies would likely provide insights into structure-function relationships within the arabinosyl transferase family.

5. Inhibitor Screening and Drug Discovery Research

The purified ArnT fragment can serve as a target for high-throughput screening of small molecule libraries to identify potential inhibitors of arabinose transfer activity. The His-tag makes protein immobilization in microplate-based assays more straightforward for compound screening. Identified hits can be further characterized for binding affinity, specificity, and mechanism of inhibition using biochemical assays. This research application supports development of new antimicrobial strategies targeting bacterial cell wall modification enzymes, though clinical translation would require extensive additional work.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
Glycosyltransferase 83 family
Database Links

KEGG: kpe:KPK_0270

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*