Recombinant Klebsiella pneumoniae Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT), partial

In Stock
Code CSB-EP471321KBH
Abbreviation Recombinant Klebsiella pneumoniae arnT protein, partial
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
4-amino-4-deoxy-L-arabinose lipid A transferase Lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase Undecaprenyl phosphate-alpha-L-Ara4N transferase
Species
Klebsiella pneumoniae (strain 342)
Source
E.coli
Expression Region
429-551aa
Target Protein Sequence
RVIDSKQPQFLVDIVSESLQPSRYVLTNNVGIAGGLAWELKRSDIIMFDKQGELKYGLDWPDAQGSFVSQAGFADWLATHRQQGPVSLVLLMDKGESMVDLPLPKPDNAYELGRVVFLQYLPQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Klebsiella pneumoniae Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase (arnT) is expressed in E. coli and includes an N-terminal 6xHis-tag for simplified purification. The product represents a partial protein spanning amino acids 429-551 and achieves greater than 90% purity as determined by SDS-PAGE. This research-use-only protein serves as a reliable tool for laboratory studies requiring high-quality reagents.

The arnT gene in Klebsiella pneumoniae encodes a protein that appears to play a crucial role in bacterial resistance mechanisms. Acting as an arabinosyl transferase, it modifies lipopolysaccharides—key components of the bacterial outer membrane. This modification may influence the bacterium's susceptibility to certain antibiotics, which makes arnT a significant focus in microbial resistance studies and a potentially valuable target for antibacterial research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The recombinant Klebsiella pneumoniae ArnT fragment (429–551aa), expressed in E. coli with an N-terminal 6xHis tag, represents a small C-terminal portion of a large integral membrane enzyme. ArnT is a membrane-bound arabinosyltransferase involved in lipid A modification, and its enzymatic activity depends on the full transmembrane and periplasmic architecture for correct folding and function.

Because this fragment was expressed in a bacterial cytoplasmic expression system (E. coli) without its transmembrane domains or membrane context, it is highly unlikely to fold correctly or retain any enzymatic or binding activity. Instead, it is expected to exist as a soluble or partially misfolded peptide representing a linear antigenic region. Thus, this protein is unsuitable for biochemical or enzymatic characterization, but highly appropriate for antibody generation and epitope mapping, as well as potentially for secondary structural or limited biophysical studies of the isolated domain.

1. Antibody Development and Validation

This ArnT fragment is well-suited for antibody production and screening. If the fragment is partially folded, antibodies raised against it may recognize native epitopes in the full-length ArnT protein. If misfolded, it still functions effectively as a source of linear epitopes for generating polyclonal or monoclonal antibodies, useful in Western blot, ELISA, and immunodetection assays.
The high purity (>90%) and His-tag simplify both immunization and antibody validation, ensuring minimal cross-reactivity and efficient purification.

2. Structural and Biophysical Analysis

This recombinant ArnT fragment may be useful for limited biophysical characterization, such as circular dichroism (CD) or dynamic light scattering (DLS), to assess secondary structure content and stability of the C-terminal region. If the fragment adopts partial folding, it could provide insights into local secondary structure motifs of ArnT. However, because it lacks membrane context and may aggregate in aqueous solution, high-resolution structure determination (X-ray, NMR, cryo-EM) is unlikely to succeed without extensive refolding optimization or fusion strategies.

Final Recommendation & Action Plan

The recombinant ArnT fragment expressed in E. coli is a non-functional C-terminal fragment of a membrane protein and thus cannot perform the enzymatic or physiological roles of native ArnT. However, its high purity and ease of purification make it ideal for antibody development, epitope mapping, and possibly secondary structure characterization. Focus this protein’s use on antibody generation and validation applications, where linear or partially folded epitopes suffice. Avoid kinetic, inhibitor, or protein-interaction studies, as the fragment lacks structural integrity and active-site residues. For functional enzymatic assays, use full-length ArnT reconstituted in a membrane-mimetic system (e.g., detergent micelles or nanodiscs).

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Catalyzes the transfer of the L-Ara4N moiety of the glycolipid undecaprenyl phosphate-alpha-L-Ara4N to lipid A. The modified arabinose is attached to lipid A and is required for resistance to polymyxin and cationic antimicrobial peptides.
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.
Protein Families
Glycosyltransferase 83 family
Database Links

KEGG: kpe:KPK_0270

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*