Recombinant Kluyveromyces marxianus DNA-directed RNA polymerases I, II, and III subunit RPABC1 (RPB5)

In Stock
Code CSB-EP889203KAN
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
RPB5
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
RPB5; DNA-directed RNA polymerases I; II; and III subunit RPABC1; RNA polymerases I; II; and III subunit ABC1
Species
Kluyveromyces marxianus (Yeast) (Candida kefyr)
Source
E.coli
Expression Region
1-215aa
Target Protein Sequence
MDQEQERGISRLWRAFRTVKEMVRDRGYFITQEEIDLSLEDFKVKYCDSMGKPQRKMMSFQSNPTEESIEKFPEMGSLWVEFCDEASVGVKTMKNFVVHITEKNFQTGIFIYQSGITPSANKILPTAAPAVIETFPEASLVVNITHHELVPKHIRLSDAEKKELLKRYRLKESQLPRIQRMDPVALYLGLKRGEVIKIIRKSETSGRYASYRICL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
29.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Expressing the recombinant Kluyveromyces marxianus (Yeast) RPB5 protein in e.coli cells involves inserting a DNA fragment encoding the Kluyveromyces marxianus (Yeast) RPB5 protein (1-215aa) into a plasmid vector and transferring it to the e.coli cells. Positive cells are screened, cultured, and induced to express the RPB5 protein. The protein carries a N-terminal 6xHis tag. The cells are lysed to collect the recombinant Kluyveromyces marxianus (Yeast) RPB5 protein, which is purified through affinity purification and then identified using SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of the resulting recombinant Kluyveromyces marxianus (Yeast) RPB5 protein exceeds 85%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process.
Subcellular Location
Nucleus.
Protein Families
Archaeal RpoH/eukaryotic RPB5 RNA polymerase subunit family
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*