Recombinant Leiurus quinquestriatus quinquestriatus Beta-insect excitatory toxin LqqIT1

In Stock
Code CSB-EP324858LDT
Product Type Recombinant Protein
Size EP: USD797
Uniprot No. P19856
Storage Buffer Tris-based buffer,50% glycerol
Species Leiurus quinquestriatus quinquestriatus(Egyptian scorpion)(Deathstalker scorpion)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN
Research Area Others
Source E.coli
Gene Names N/A
Protein Names Recommended name: Beta-insect excitatory toxin LqqIT1 Short name= Insect toxin 1 Short name= LqqIT1'
Expression Region 1-70aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 12.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Excitatory insect beta-toxins induce a spastic paralysis. They bind voltage-independently at site-4 of sodium channels (Nav) and shift the voltage of activation toward more negative potentials thereby affecting sodium channel activation and promoting spontaneous and repetitive firing. This toxin induces a fast excitatory contraction paralysis on fly larvae. It is active only on insects.
Subcellular Location Secreted
Protein Families Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Beta subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

N/A Proteins

N/A Proteins for Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.