Recombinant Lentinula edodes Serine protease inhibitor

In Stock
Code CSB-EP305524LDV
Abbreviation Recombinant Lentinula edodes Serine protease inhibitor protein
MSDS
Size US$388
Order now
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP305524LDV could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes) N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP305524LDV could indicate that this peptide derived from E.coli-expressed Lentinula edodes (Shiitake mushroom) (Lentinus edodes) N/A.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Uniprot No.
Research Area
Others
Alternative Names
; Serine protease inhibitor
Species
Lentinula edodes (Shiitake mushroom) (Lentinus edodes)
Source
E.coli
Expression Region
1-142aa
Target Protein Sequence
SLETGRYLIHNGNNIVSRNLAEDRSLNPKRIVLLEPTDKIQLTWIIEKSGDEYILNNRGAPTAHIEDHVFALLIHQEGATKWSIEAVPRHGRNAYIIKGSDGKGWVAPDKAGEQIIYRTLIVGPSEPPTFPLNQVFQIIKLE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.0 kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Lentinula edodes Serine protease inhibitor is expressed in E. coli and contains the complete protein sequence, spanning amino acids 1-142. The protein carries an N-terminal 6xHis tag, which appears to simplify both purification and detection processes. SDS-PAGE analysis indicates the product's purity exceeds 85%, though this may vary slightly between batches. Low endotoxin levels make it potentially suitable for in vitro studies, although researchers should verify compatibility with their specific experimental conditions.

Lentinula edodes Serine protease inhibitor comes from the Shiitake mushroom and seems to play a role in regulating protease activity. The protein likely controls proteolytic processes within biological systems by inhibiting serine proteases. This regulatory function appears important for various cellular pathways, which could make the protein useful for research into protease-related functions and interactions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Lentinula edodes serine protease inhibitor is a protein that requires precise folding, proper disulfide bond formation (if present in native structure), and specific tertiary structure for its functional activity in protease inhibition. The E. coli expression system can produce soluble proteins but may not support an optimal eukaryotic folding environment or correct disulfide bond formation. The N-terminal 6xHis-tag is relatively small and may cause minimal steric interference. While the full-length protein (1-142aa) contains all functional domains, the probability of correct folding with functional protease inhibitory activity requires experimental validation. Serine protease inhibitors typically require precise reactive site loop conformation for effective inhibition.

1. Protease Inhibition Screening Assays

This application carries a significant risk without functional validation. Protease inhibitory activity requires precise tertiary structure and proper reactive site formation. If correctly folded and active (verified through inhibition assays), the protein may be suitable for screening studies. If misfolded/inactive (unverified), inhibition assays will yield biologically meaningless results.

2. Pull-Down Assays for Protease Target Identification

This application requires proper folding validation. Protease-inhibitor interactions require native conformation of the inhibitory domain. If correctly folded (verified), the protein may identify physiological protease targets. If misfolded/unverified, there is a high risk of non-specific binding or failure to replicate genuine interactions.

3. Biochemical Characterization and Kinetic Studies

These studies are essential for determining functional status but require validated activity. Techniques should include inhibition kinetics, binding affinity measurements, and stability assays. However, meaningful characterization depends on having a functionally active inhibitor.

4. Antibody Development and Immunoassay Applications

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional protein folding. The full-length protein provides comprehensive epitope coverage for generating specific antibodies.

5. Comparative Inhibitor Studies and Structure-Function Analysis

Meaningful comparative studies require native protein conformation and functional activity. If correctly folded and active (verified), the protein enables valid evolutionary and functional comparisons. If misfolded/inactive (unverified), comparative analyses would yield misleading insights.

Final Recommendation & Action Plan

The E. coli-expressed serine protease inhibitor with His-tag may be functionally active, but requires experimental validation before most applications. Begin with functional validation using standard protease inhibition assays against known serine proteases to confirm bioactivity. Applications 1, 2, 3, and 5 all require this functional validation before proceeding. Only Application 4 (antibody development) can proceed immediately without functional validation. For reliable inhibitor research, always include positive controls with active protease-inhibitor systems and validate key findings with native protein preparations when possible.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine protease inhibitor. Active against beta-trypsin and alpha-chymotrypsin with dissociation constants of 0.35 nM and 40 nM respectively. Inhibits factor XIa, but not other enzymes involved in coagulation and fibrinolysis. Does not inhibit subtilisin, lysyl endopeptidase, arginyl endopeptidase or papain.
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*