Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN)

In Stock
Code CSB-EP810224MOV
Abbreviation Recombinant Cynomolgus monkey FXN protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
FXN; FRDA1; QnpA-13971; Frataxin; mitochondrial; Fxn; EC 1.16.3.1) [Cleaved into: Frataxin intermediate form; Frataxin mature form]
Species
Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Source
E.coli
Expression Region
81-210aa
Target Protein Sequence
SGTLGHPGSLDDTTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDLGTYVINKQTPNKQIWLSSPSSGPKRYDRTGKNWVYSHDGVSLHELLGAELTKALKTKLDLSSLAYSGKDA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Macaca fascicularis Frataxin, mitochondrial (FXN) is produced in E. coli and includes the full-length mature protein from amino acids 81 to 210. The protein carries an N-terminal 6xHis-tag to aid in purification, reaching a purity level greater than 90% as determined by SDS-PAGE. This product is strictly for research use only and cannot be used for human or clinical applications.

Frataxin appears to be a mitochondrial protein that helps regulate iron homeostasis and oxidative stress response. Research suggests it plays a critical role in the biogenesis of iron-sulfur clusters, which are essential for various enzymatic processes. Understanding frataxin's function may be crucial for studying mitochondrial pathophysiology and its implications in cellular metabolism and disease mechanisms.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Macaca fascicularis Frataxin (FXN) is expressed in E. coli, a prokaryotic system that may not fully support the correct folding of eukaryotic mitochondrial proteins. Frataxin is involved in iron-sulfur cluster biogenesis and requires precise folding for its iron-binding and protein interaction functions. The protein is expressed as the full-length mature protein (81-210aa), which includes the functional domain, but E. coli lacks the mitochondrial environment and potential chaperones needed for native conformation. The N-terminal 6xHis tag may also influence folding. Since activity is unverified, the protein cannot be assumed to be correctly folded or bioactive without experimental validation (e.g., iron-binding assays). While E. coli can sometimes produce functional proteins, the risk of misfolding remains significant for a eukaryotic protein.

1. Protein-Protein Interaction Studies Using His-Tag Pull-Down Assays

The N-terminal 6xHis tag allows for immobilization on nickel-affinity resins to identify binding partners, but if the frataxin is misfolded, it may not interact physiologically with mitochondrial proteins (e.g., iron-sulfur cluster assembly components), leading to non-specific binding or false negatives. The high purity (>90%) reduces background, but results should be interpreted cautiously until folding is confirmed. If correctly folded, this application is valuable for primate-specific studies; otherwise, it may yield misleading data.

2. Antibody Development and Validation

This application is generally suitable. The recombinant frataxin can serve as an immunogen for antibody generation, as antibodies often recognize linear epitopes less dependent on native folding. The high purity and defined region (81-210aa) support consistent immunization and validation in assays like Western blot or ELISA. However, if misfolded, antibodies may not recognize the native frataxin in mitochondrial contexts, so validation against a full-length, correctly folded protein is recommended.

3. Biochemical Characterization and Iron-Binding Studies

This application is appropriate and should be prioritized to assess folding and bioactivity. Techniques like UV-visible spectroscopy can directly test iron-binding properties, providing insights into function. The mature protein region likely contains the functional domain, but activity must be verified experimentally. If misfolded, these studies will characterize an inactive product, but they are essential for initial validation.

4. Comparative Species Analysis in Mitochondrial Function Studies

The recombinant protein can be used for comparative studies, but only if correctly folded and active. If misfolded, comparisons with orthologs in iron-sulfur cluster assembly assays may be invalid. So, folding should be confirmed first to ensure physiological relevance.

Final Recommendation & Action Plan

Given the uncertainty in folding and bioactivity, the priority is to validate the protein's conformation and function through biochemical assays (e.g., iron-binding tests using spectroscopy, circular dichroism for secondary structure, and size-exclusion chromatography for oligomeric state). If active, the protein can be reliably used for interaction studies and comparative analyses; if inactive, focus on applications like antibody development or as a control for biochemical characterization. Always include controls such as native frataxin or orthogonal assays to confirm results, and consider using eukaryotic expression systems if folding issues are detected for functional studies.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe(2+) to proteins involved in these pathways. May play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe(2+) to Fe(3+); the oligomeric form but not the monomeric form has in vitro ferroxidase activity. May be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. Modulates the RNA-binding activity of ACO1.
Subcellular Location
Cytoplasm, cytosol. Mitochondrion.
Protein Families
Frataxin family
Database Links

KEGG: mcf:102120656

UniGene: Mfa.6270

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*