Home
Active Protein
Other
Recombinant Macaca fascicularis Ig-like domain-containing protein (EGM_15593), partial (Active)

Recombinant Macaca fascicularis Ig-like domain-containing protein (EGM_15593), partial (Active)

^{In Stock}

Code	CSB-MP6751MOV
Abbreviation	Recombinant Cynomolgus monkey EGM_15593 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$290
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/ml can bind Anti-HAVCR2 recombinant antibody (CSB-RA010145MA1HU). The EC₅₀ is 1.062-1.282 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/ml can bind Anti-HAVCR2 recombinant antibody (CSB-RA010145MA2HU). The EC₅₀ is 4.000-4.556 ng/mL. Biological Activity Assay Activity HAVCR2 Recombinant Monoclonal Antibody (CSB-RA010145MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 6.94 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay Activity HAVCR2 Recombinant Monoclonal Antibody (CSB-RA010145MA2HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 5.82 nM as detected by MetaSPR Assay (WeSPRTM 200). Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Customer Reviews and Q&A

Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/mL can bind Anti-HAVCR2 recombinant antibody (CSB-RA010145MA1HU). The EC50 is 1.062-1.282 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Macaca fascicularis HAVCR2 at 2 μg/mL can bind Anti-HAVCR2 recombinant antibody (CSB-RA010145MA2HU). The EC50 is 4.000-4.556 ng/mL.
③HAVCR2 Recombinant Monoclonal Antibody (CSB-RA010145MA1HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 6.94 nM as detected by MetaSPR Assay (WeSPRTM 200).CSB-MP6751MOV
④HAVCR2 Recombinant Monoclonal Antibody (CSB-RA010145MA2HU) captured on Protein A Chip can bind Recombinant Macaca fascicularis HAVCR2 with an affinity constant of 5.82 nM as detected by MetaSPR Assay (WeSPRTM 200).

Target Names

EGM_15593

Uniprot No.

G7P6Q7

Alternative Names

Ig-like domain-containing protein

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Mammalian cell

Expression Region

22-201aa

Target Protein Sequence

SEVEYIAEVGQNAYLPCSYTPAPPGNLVPVCWGKGACPVFDCSNVVLRTDNRDVNDRTSGRYWLKGDFHKGDVSLTIENVTLADSGVYCCRIQIPGIMNDEKHNVKLVVIKPAKVTPAPTLQRDLTSAFPRMLTTGEHGPAETQTPGSLPDVNLTVSNFFCELQIFTLTNELRDSGATIR

Mol. Weight

21.1 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

HAVCR2, also known as TIM-3, serves as a critical immune checkpoint receptor in T cell exhaustion pathways, making its cynomolgus macaque ortholog essential for translational immunotherapy research in non-human primate models. This recombinant protein spanning residues 22–201 demonstrates robust binding to anti-HAVCR2 monoclonal antibodies with EC50 values of 1.062–1.282 ng/mL and 4.000–4.556 ng/mL in functional ELISA, while surface plasmon resonance confirms high-affinity interactions with KD values of 6.94 nM and 5.82 nM for two distinct antibody clones. These quantitative binding metrics support use in antibody screening campaigns, epitope mapping studies, and competitive binding assays where precise affinity measurements guide lead candidate selection. Mammalian cell expression yields protein with >90% purity and endotoxin levels below 1.0 EU/μg, satisfying the quality criteria typical for functional immunoassays and in vitro antibody characterization workflows.