Home
Protein
Recombinant Proteins
Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

Recombinant Macaca fascicularis T-cell surface glycoprotein CD3 gamma chain (CD3G), partial

^{In Stock}

Code	CSB-YP850179MOV
Abbreviation	Recombinant Cynomolgus monkey CD3G protein, partial
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CD3G

Uniprot No.

Q95LI7

Research Area

Immunology

Alternative Names

CD3GT-cell surface glycoprotein CD3 gamma chain; T-cell receptor T3 gamma chain; CD antigen CD3g

Species

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Source

Yeast

Expression Region

23-113aa

Target Protein Sequence

QSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

12.5kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Introducing our Recombinant Macaca fascicularis CD3G, specifically engineered for immunology research and applications involving the T-cell surface glycoprotein CD3 gamma chain. Derived from Macaca fascicularis (Crab-eating macaque or Cynomolgus monkey), this protein encompasses the extracellular domain with an expression region of 23-113aa, ensuring a high-quality product for your research needs.

Produced in a yeast expression system, our CD3G protein is equipped with an N-terminal 6xHis tag for straightforward purification and detection processes. With a purity greater than 90% as determined by SDS-PAGE, our recombinant protein is available in both liquid and lyophilized powder forms to suit your specific experimental requirements. Trust our precision-crafted Recombinant Macaca fascicularis CD3G to deliver consistent, reliable results for your immunology research.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition to this role of signal transduction in T-cell activation, CD3G plays an essential role in the dynamic regulation of TCR expression at the cell surface. Indeed, constitutive TCR cycling is dependent on the di-leucine-based (diL) receptor-sorting motif present in CD3G.

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Database Links

KEGG: mcf:102134381

UniGene: Mfa.6116

Promotions